PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45760.1
Common NameLOC4330327, OJ1123_G04.1, Os02g0681900, OsJ_07941, OSNPB_020681900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 619aa    MW: 64200.5 Da    PI: 9.3166
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3043.7e-932546182374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL e+A av++g++++a +lL+ l+  a+p+gd+ qRl+a+++ AL++r+           p+++ ++  s e+ aa +l+++vsP++ ++
  LOC_Os02g45760.1 254 RQLLSEAAAAVADGNHTAAASLLSALKLSANPRGDAEQRLVAMMVAALSSRVGT--------GPSQHLADLYSGEHRAACQLLQDVSPCFGLA 338
                       689*************************************************98........5666666666899999*************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg....skeeleetgerLakfAeelgvpfefnvlva 183
                          aN aIl+av+g++++H +Dfd+s  +Q +aL++aLa+R+ ++ sl++T+v++p+s      +++l +t erL+k+A++ g++f+f++ v+
  LOC_Os02g45760.1 339 LHGANLAILDAVAGHRAIHLVDFDVSA-AQHVALIKALADRRVPATSLKVTVVADPTSPftpaMTQSLAATCERLKKLAQQAGIDFRFRA-VS 429
                       *************************85.8**************************9988899999*************************.78 PP

              GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                        r  ++e ++L ++pgEalaVnl++ l r++desvs +++rde+L+ v+ l P+vv++veqe+++n+++ ++rf++a  +y a+++sl+a+l+
  LOC_Os02g45760.1 430 CRAPEIEASKLGCEPGEALAVNLAFTLSRVPDESVSPANPRDELLRRVRALGPRVVTLVEQELNTNTAPMAARFSDASAHYGAVLESLDATLG 522
                       99******************************************************************************************* PP

              GRAS 277 reseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvs 369
                       r+s +r+  E++ l+ ++ n+v  eg +r+er+e ++kWr+r+++aGF++v+++e++   +++ l       + v+ ++g l  gW++r +++
  LOC_Os02g45760.1 523 RDSADRTRAEAA-LASKVANAVGREGPDRVERCEVFGKWRARFGMAGFRAVAIGEDIGGRVRARLGPAL-PAFDVKLDNGRLGVGWMGRVVTV 613
                       ***********9.9***************************************************9998.66********************* PP

              GRAS 370 vSaWr 374
                       +SaWr
  LOC_Os02g45760.1 614 ASAWR 618
                       ****8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.282227599IPR005202Transcription factor GRAS
PfamPF035141.3E-90254618IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 619 aa     Download sequence    Send to blast
MDPAGAPWCD PRRGYGGYGV GSAALQAAAR QQSQQPRSDG AGGAGVTGGV LKRSLGEMER  60
WQQQRQVAAQ QAMYLRSVRQ RMDIGAVLGG AASSPAYGIS GLSSGFGGIS QQQPSSTMSS  120
LTTASRTVMP GMQQRRRMMA VPTAQNQAVA RAPAARPATA TELVLLQELE KQLLGDDEEA  180
DAAGSGCGSG ITSSDWGDTI QRLNSVTAAS SPSLPLPTAV NSTALLARSP TNSSSSTASS  240
SASSSPPISA ASSRQLLSEA AAAVADGNHT AAASLLSALK LSANPRGDAE QRLVAMMVAA  300
LSSRVGTGPS QHLADLYSGE HRAACQLLQD VSPCFGLALH GANLAILDAV AGHRAIHLVD  360
FDVSAAQHVA LIKALADRRV PATSLKVTVV ADPTSPFTPA MTQSLAATCE RLKKLAQQAG  420
IDFRFRAVSC RAPEIEASKL GCEPGEALAV NLAFTLSRVP DESVSPANPR DELLRRVRAL  480
GPRVVTLVEQ ELNTNTAPMA ARFSDASAHY GAVLESLDAT LGRDSADRTR AEAALASKVA  540
NAVGREGPDR VERCEVFGKW RARFGMAGFR AVAIGEDIGG RVRARLGPAL PAFDVKLDNG  600
RLGVGWMGRV VTVASAWR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-382496181375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497020.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379903980.0
Expression AtlasQ84PD5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2244260.0AY224426.1 Oryza sativa (japonica cultivar-group) isolate 20145 scarecrow transcriptional regulator-like protein mRNA, complete cds.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041780.0AP004178.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1123_G04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.10.0PREDICTED: scarecrow-like protein 8
TrEMBLQ84PD50.0Q84PD5_ORYSJ; Os02g0681900 protein
STRINGLOC_Os02g45760.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7599918
MonocotsOGMP41883474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52510.13e-94SCARECROW-like 8
Publications ? help Back to Top
  1. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]