PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45670.1
Common NameLOC9272080, Os02g0680700, OsJ_07933, OSNPB_020680700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 292aa    MW: 31834.9 Da    PI: 9.2478
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45670.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.71.3e-133781147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  LOC_Os02g45670.1 37 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 81
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-173187IPR009057Homeodomain-like
PROSITE profilePS5129415.4083286IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-73587IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-183584IPR006447Myb domain, plants
SMARTSM007175.3E-113684IPR001005SANT/Myb domain
PfamPF002492.3E-113781IPR001005SANT/Myb domain
CDDcd001671.52E-83982No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVSANQPPPD AAAAAAGSAG EDASKKVRKP YTITKSRESW TEQEHDKFLE ALQLFDRDWK  60
KIEAFVGSKT VIQIRSHAQK YFLKVQKNGT SEHVPPPRPK RKAAHPYPQK ASKNEPGYTI  120
KADSSSMLRN SGMNATVSSW THNSIPPIVA SSMVKEDLGA GAMAPNNFCS SSTEGPARAW  180
QPGETNDQIN QVPSLRLMPD FAQVYSFLGS VFDPSTSGHL QKLKEMNPID VETALLLMRN  240
LSINLTSPDF EDQKKLLSSY STPSDGLELG STRSSVLADR PLSAPFMIKG E*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.124840.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567646740.0
Expression AtlasB9F1T8-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2880590.0AK288059.1 Oryza sativa Japonica Group cDNA, clone: J075153L04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627665.10.0PREDICTED: protein REVEILLE 6 isoform X2
SwissprotQ8H0W31e-104RVE6_ARATH; Protein REVEILLE 6
TrEMBLB9F1T80.0B9F1T8_ORYSJ; Os02g0680700 protein
STRINGLOC_Os02g45670.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.19e-88MYB_related family protein