PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45570.2
Common NameGRF10, LOC4330314, Os02g0678800, OSJNBb0005A04.34, P0663F07.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRF
Protein Properties Length: 210aa    MW: 22140.1 Da    PI: 9.5815
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45570.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.21.9e-25133177145
               WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                       +++pgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr rsrk++e+
  LOC_Os02g45570.2 133 EPDPGRCRRTDGKKWRCSRDVVPGHKYCERHVHRGRGRSRKPVEA 177
                       699***************************************997 PP

2QLQ52.31.7e-1868103237
               QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                       a+T +Q q+L++Q+l+y+y+aa++PvP +L+++i+k
  LOC_Os02g45570.2  68 ALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWK 103
                       79*********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-567103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.22568103IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.7E-1168102IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.548133177IPR014977WRC domain
PfamPF088794.7E-21134176IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MDEEKEADSP QPPSKLPRLS GADPNAGVVT MAAPPPPVGL GLGLGLGGDS RGERDVEASA  60
AAAHKATALT FMQQQELEHQ VLIYRYFAAG APVPVHLVLP IWKSVASSSF GPHRFPSLMG  120
LGNLCFDYRS SMEPDPGRCR RTDGKKWRCS RDVVPGHKYC ERHVHRGRGR SRKPVEASAA  180
ATPANNGGGG GIVFSPTSVL LAHGTARAT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.473230.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6EPP9
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45570.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45570
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1081700.0AK108170.1 Oryza sativa Japonica Group cDNA clone:002-139-H11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624932.11e-153PREDICTED: growth-regulating factor 10 isoform X2
SwissprotQ6EPP91e-130GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A0D9YWF41e-151A0A0D9YWF4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CPS51e-151A0A0E0CPS5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0GBD21e-151A0A0E0GBD2_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NJ791e-151A0A0E0NJ79_ORYRU; Uncharacterized protein
TrEMBLA2X8B11e-151A2X8B1_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA008811-PA1e-150(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36400.18e-37growth-regulating factor 3
Publications ? help Back to Top
  1. Choi D,Kim JH,Kende H
    Whole genome analysis of the OsGRF gene family encoding plant-specific putative transcription activators in rice (Oryza sativa L.).
    Plant Cell Physiol., 2004. 45(7): p. 897-904
    [PMID:15295073]