PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45250.1
Common NameGL2-5, LOC4330297, Os02g0674800, OsJ_07908, P0657H12.28, ROC5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 805aa    MW: 86047.2 Da    PI: 5.4935
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45250.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.3e-2199154156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       +++ +++t++q++eLe+lF+++++p++++r+eL+++l+L+ rqVk+WFqNrR+++k
  LOC_Os02g45250.1  99 KKRYHRHTPQQIQELEALFKECPHPDEKQRAELSRRLSLDARQVKFWFQNRRTQMK 154
                       678899***********************************************999 PP

2START187.18.9e-593145461206
                       HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT-S.... CS
             START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetla.... 77 
                       ela +a++elvk+a+ ++p+Wv         e +n +e+l +f +  +     + +ea+r+sg+v+ +    lve+l+d + +W+ ++     
  LOC_Os02g45250.1 314 ELAISAMDELVKMAQMDDPLWVPALpgspskEVLNFEEYLHSFLPCIGmkpagYVSEASRESGLVIIDNSlALVETLMDER-RWSDMFScmia 405
                       57889*****************99978888888888888888888877*****************9876658999999999.*********** PP

                       EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE..-TTS--....-TTSEE-EESSEEEEEEEEC CS
             START  78 kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvd..seqkppe...sssvvRaellpSgiliepks 158
                       ka++le +s+g      gal lm+aelq+lsplvp R+++f+R+++ql +g w++vdvS+d  ++++++    + + v++++ pSg+++++++
  LOC_Os02g45250.1 406 KATVLEEVSTGiagsrnGALLLMKAELQVLSPLVPiREVTFLRFCKQLAEGAWAVVDVSIDglVRDHNSGtapTGGNVKCRRVPSGCVMQDTP 498
                       ************************************************************96556666667678899**************** PP

                       TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
             START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                       ng++kvtwveh++++++++h+l+r+l++sgla+ga++w+atlqrqce+
  LOC_Os02g45250.1 499 NGYCKVTWVEHTEYDEASVHQLYRPLLRSGLAFGARRWLATLQRQCEC 546
                       **********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-2283150IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2189156IPR009057Homeodomain-like
PROSITE profilePS5007118.12396156IPR001356Homeobox domain
SMARTSM003891.5E-1997160IPR001356Homeobox domain
CDDcd000865.35E-1998156No hitNo description
PfamPF000469.5E-1999154IPR001356Homeobox domain
PROSITE patternPS000270131154IPR017970Homeobox, conserved site
PROSITE profilePS5084845.039305549IPR002913START domain
SuperFamilySSF559612.91E-32308546No hitNo description
CDDcd088751.23E-113309545No hitNo description
SMARTSM002341.5E-47314546IPR002913START domain
PfamPF018523.7E-51315546IPR002913START domain
SuperFamilySSF559613.41E-21567770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 805 aa     Download sequence    Send to blast
MSFGGLFDGG GGGGMQFPFA SGFASSPALS LALDNAGGGI GGRMLGGGAG AGSSAGGAMT  60
RDTEAENDSR SGSDHLDAIS AAGEDDVEDA EPSNSRKRKK RYHRHTPQQI QELEALFKEC  120
PHPDEKQRAE LSRRLSLDAR QVKFWFQNRR TQMKTQLERH ENALLKQEND KLRAENMTIR  180
EAMRSPMCGS CGSPAMLGEV SLEEQHLRIE NARLKDELNR VCALATKFLG KPISLLSPPP  240
LLQPHLSLPM PNSSLELAIG GIGGLGSLGT LPGCMNEFAG GVSSPMGTVI TPARATGAAI  300
PSLVGNIDRS VFLELAISAM DELVKMAQMD DPLWVPALPG SPSKEVLNFE EYLHSFLPCI  360
GMKPAGYVSE ASRESGLVII DNSLALVETL MDERRWSDMF SCMIAKATVL EEVSTGIAGS  420
RNGALLLMKA ELQVLSPLVP IREVTFLRFC KQLAEGAWAV VDVSIDGLVR DHNSGTAPTG  480
GNVKCRRVPS GCVMQDTPNG YCKVTWVEHT EYDEASVHQL YRPLLRSGLA FGARRWLATL  540
QRQCECLAIL MSSATVTAND STAISQEGKR SMLKLARRMT ENFCAGVSAS SAREWSKLDG  600
ATGSIGEDVR VMARKSVSEP GEPPGVVLSA ATSVWVPVAP EKLFNFLRDE QLRAEWDILS  660
NGGPMQEMTQ IAKGQRDGNS VSLLRASAVS ANQSSMLILQ ETCTDASGSI VVYAPVDIPA  720
MQLVMNGGDS TYVALLPSGF AILPDGPRIG ATGYETGGSL LTVAFQILVN NQPTAKLTVE  780
SVETVNNLIS CTIKKIKTAL QCDA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14047GGRMLGGG
29599RKRKK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.60390.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379882070.0
Expression AtlasQ6EPF0-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45250.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45250
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016480.0AB101648.1 Oryza sativa Japonica Group Roc5 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625616.10.0PREDICTED: homeobox-leucine zipper protein ROC5
SwissprotQ6EPF00.0ROC5_ORYSJ; Homeobox-leucine zipper protein ROC5
TrEMBLA0A0D3F8T40.0A0A0D3F8T4_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NJ490.0A0A0E0NJ49_ORYRU; Uncharacterized protein
TrEMBLA0A0D9YWC50.0A0A0D9YWC5_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g45250.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
MonocotsOGMP120337116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1