PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45200.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 367aa    MW: 36903.9 Da    PI: 8.7349
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45200.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.3e-3961122263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  LOC_Os02g45200.4  61 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 122
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3157119IPR003851Zinc finger, Dof-type
PfamPF027012.4E-3363119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05965119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MEEMLMGANP NPNGSSNQPP PPPSSAASAQ RPIAPPAAGA AAGAGAAGAG AGTERRARPQ  60
KEKALNCPRC NSTNTKFCYY NNYSLQQPRY FCKTCRRYWT EGGSLRNVPV GGGSRKNKRS  120
SSSVVPSAAA SASTSAAVSG SVPVGLAAKN PKLMHEGAQD LNLAFPHHHG RALQPPEFTA  180
FPSLESSSVC NPGGNLAAAN GAGGRGSVGA FSAMELLRST GCYVPLPQMA PLGMPAEYAA  240
AGFHLGEFRM PPPPQQQQQQ QAQTVLGFSL DTHGAGAGGG SGVFGACSAG LQESAAGRLL  300
FPFEDLKPVV SAAAGDANSG GDHQYDHGKN QGGGGGVIGG HEAPGFWNSS MIGNGSSNGG  360
GGGGSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41830.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640620.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45200.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0058850.0AP005885.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0657H12.
GenBankAB0281300.0AB028130.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-9.
GenBankAK2874470.0AK287447.1 Oryza sativa Japonica Group cDNA, clone: J043016O04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627551.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X2
TrEMBLA0A0D9YWB90.0A0A0D9YWB9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NJ430.0A0A0E0NJ43_ORYRU; Uncharacterized protein
STRINGLOC_Os02g45200.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.18e-43Dof family protein