PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45200.2
Common NameOs02g0673700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 376aa    MW: 37886.1 Da    PI: 8.9056
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45200.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.3e-3970131263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  LOC_Os02g45200.2  70 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 131
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3166128IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3372128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05974128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MWGLGLVKPM EEMLMGANPN PNGSSNQPPP PPSSAASAQR PIAPPAAGAA AGAGAAGAGA  60
GTERRARPQK EKALNCPRCN STNTKFCYYN NYSLQQPRYF CKTCRRYWTE GGSLRNVPVG  120
GGSRKNKRSS SSVVPSAAAS ASTSAAVSGS VPVGLAAKNP KLMHEGAQDL NLAFPHHHGR  180
ALQPPEFTAF PSLESSSVCN PGGNLAAANG AGGRGSVGAF SAMELLRSTG CYVPLPQMAP  240
LGMPAEYAAA GFHLGEFRMP PPPQQQQQQQ AQTVLGFSLD THGAGAGGGS GVFGACSAGL  300
QESAAGRLLF PFEDLKPVVS AAAGDANSGG DHQYDHGKNQ GGGGGVIGGH EAPGFWNSSM  360
IGNGSSNGGG GGGSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41830.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640620.0
Expression AtlasQ9SXG7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45200.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281300.0AB028130.1 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627550.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X1
TrEMBLQ9SXG70.0Q9SXG7_ORYSJ; Dof zinc finger protein
STRINGLOC_Os02g45200.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.18e-43Dof family protein