PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45200.1
Common NameLOC4330293, Os02g0673700, OsJ_07904, OSNPB_020673700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 382aa    MW: 38545.8 Da    PI: 8.7354
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45200.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1252.4e-3976137263
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                       kekal+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  LOC_Os02g45200.1  76 KEKALNCPRCNSTNTKFCYYNNYSLQQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 137
                       7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3172134IPR003851Zinc finger, Dof-type
PfamPF027012.6E-3378134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05980134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MDAAHWHQGL GLVKPMEEML MGANPNPNGS SNQPPPPPSS AASAQRPIAP PAAGAAAGAG  60
AAGAGAGTER RARPQKEKAL NCPRCNSTNT KFCYYNNYSL QQPRYFCKTC RRYWTEGGSL  120
RNVPVGGGSR KNKRSSSSVV PSAAASASTS AAVSGSVPVG LAAKNPKLMH EGAQDLNLAF  180
PHHHGRALQP PEFTAFPSLE SSSVCNPGGN LAAANGAGGR GSVGAFSAME LLRSTGCYVP  240
LPQMAPLGMP AEYAAAGFHL GEFRMPPPPQ QQQQQQAQTV LGFSLDTHGA GAGGGSGVFG  300
ACSAGLQESA AGRLLFPFED LKPVVSAAAG DANSGGDHQY DHGKNQGGGG GVIGGHEAPG  360
FWNSSMIGNG SSNGGGGGGS W*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41830.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567640620.0
Expression AtlasB9F1L8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45200
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2874470.0AK287447.1 Oryza sativa Japonica Group cDNA, clone: J043016O04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627550.10.0PREDICTED: dof zinc finger protein DOF4.6 isoform X1
TrEMBLA0A0D9YWC10.0A0A0D9YWC1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NJ450.0A0A0E0NJ45_ORYRU; Uncharacterized protein
TrEMBLB9F1L80.0B9F1L8_ORYSJ; Os02g0673700 protein
STRINGLOC_Os02g45200.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP23693486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-42Dof family protein