PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g45080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 254aa    MW: 28576.9 Da    PI: 10.7736
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g45080.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.25.9e-312072254
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                      prlrWt eLH++Fv+a++ LGG++kAtPk il+lm+v gLt++hvkSHLQ+YR
  LOC_Os02g45080.1 20 PRLRWTAELHRSFVRAIDCLGGQQKATPKLILQLMDVRGLTISHVKSHLQMYR 72
                      8**************************************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-291673IPR009057Homeodomain-like
PROSITE profilePS5129411.0771676IPR017930Myb domain
SuperFamilySSF466892.15E-151872IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-222072IPR006447Myb domain, plants
PfamPF002491.9E-62172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MGISGERKGA ARQYNRSKVP RLRWTAELHR SFVRAIDCLG GQQKATPKLI LQLMDVRGLT  60
ISHVKSHLQM YRGTRHGIGQ NDMQPQLHLK QHSFGSDEQS PKEFMCPPIK RAKVGTEASG  120
KYRCMEGSSD MRSSAPPAGT RYFIDDCMRL QEVSMDRRRS DQHDAAAAAR ARAPAAAASS  180
LHQALGFWVQ GRREEPFMVH QISKPKAHQL NHMVRNMKIS CKENHESRFF MSLVMVLLLI  240
SADLVSRETP SKL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g45080.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g45080
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126101e-151CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149581e-151AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0041881e-151AP004188.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1493_H11.
GenBankAP0041601e-151AP004160.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1197_E09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624520.11e-174PREDICTED: uncharacterized protein LOC107276067
TrEMBLI1P3100.0I1P310_ORYGL; Uncharacterized protein
STRINGLOC_Os02g45080.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.17e-32G2-like family protein