PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g43300.1
Common NameLOC4330152, P0048B08.5, P0519A12.36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 629aa    MW: 67740.1 Da    PI: 4.597
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g43300.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.22.5e-2988172187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+++e+laLi++r+em+ ++r++ lk+p Wee s++++e g++rs k+Ckek+en+ k+yk++keg+ +r++++s  +++f+qlea
  LOC_Os02g43300.1  88 RWPREETLALIRIRSEMDAAFRNATLKAPVWEELSRRLAELGYQRSGKKCKEKFENVDKYYKRTKEGRTGRQDGKS--YRFFSQLEA 172
                       8*********************************************************************866665..*******85 PP

2trihelix1086.4e-34395480187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k+ev+aLi++r e+ee++++   k+plWee+++ m++ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  LOC_Os02g43300.1 395 RWPKEEVQALIDLRMEKEEQYNDMGPKGPLWEEIAAGMQRIGYNRSAKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLDA 480
                       8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.2285147IPR001005SANT/Myb domain
CDDcd122032.23E-2787152No hitNo description
PfamPF138375.7E-2187173No hitNo description
PROSITE profilePS500907.08587145IPR017877Myb-like domain
SMARTSM007171.0E-5392454IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-5394451IPR009057Homeodomain-like
PROSITE profilePS500907.851394452IPR017877Myb-like domain
CDDcd122035.87E-27394459No hitNo description
SuperFamilySSF466898.54E-5394462IPR009057Homeodomain-like
PfamPF138372.5E-22395481No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010192Biological Processmucilage biosynthetic process
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 629 aa     Download sequence    Send to blast
MQHPQGAGDP PYGVVPAPPT MAAAFDLPPV TTPAPAAPSD VLLPTQPQVS GPEEFPAAAV  60
NSNDDDMMMV DDVVVAGGVG GSGSTGNRWP REETLALIRI RSEMDAAFRN ATLKAPVWEE  120
LSRRLAELGY QRSGKKCKEK FENVDKYYKR TKEGRTGRQD GKSYRFFSQL EALHAAAPPP  180
PPQQRQGMPV EDPQPLAMAW MMLPGAADLG FLSMSSESES DDESDEEEEE EEAVAPGGGG  240
REGLGDDGDG DGEGGSSTRK LMAMFEGMMR QVTEKQDAMQ RVFLETLEKW EAERTEREEA  300
WRRKEVARIN REREQLSKER AAAASRDAAL IAFLQRVGGA GGEPVRLSPS SAGATRHDAA  360
AAGLQLVPVP APRAKAEDAW AAAGGDGSGT TAPSRWPKEE VQALIDLRME KEEQYNDMGP  420
KGPLWEEIAA GMQRIGYNRS AKRCKEKWEN INKYFKKVKE SNKRRPEDSK TCPYFHQLDA  480
IYRKKHFAGR GGGGGGVTIA ASHSSLAIVT VSEQDNPSQR ELEGKSSNDV GNVQLAVPLL  540
VHNAPDKKVE GSEGEPNVTA AAEETDSDEM CGEYTDDGDD DDKMQYKIEF QKPTAGGGGD  600
GNDAPVPATT AAATSSAPTS NTSFLAVQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.134660.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884050.0
Expression AtlasQ6H6S9-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00243DAPTransfer from AT1G76880Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g43300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g43300
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117420.0AK111742.1 Oryza sativa Japonica Group cDNA clone:J023050K14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622654.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLQ6H6S90.0Q6H6S9_ORYSJ; Putative DNA-binding protein Gt-2
STRINGLOC_Os02g43300.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.22e-46Trihelix family protein