PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g43170.2
Common NameLOC4330144, Os02g0646200, OSNPB_020646200, P0030D07.27, P0519A12.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 209aa    MW: 21619 Da    PI: 5.0423
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g43170.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.42.1e-06443538
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                       C+ +  + ++ fC  ++  lC+ C    H+       H+
  LOC_Os02g43170.2  4 QCDVCAAEAASVFCCADEAALCDACDHRVHRAnklagkHR 43
                      7*****************************7677777776 PP

2zf-B_box24.55.6e-086294335
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                      ++ C+ ++ek+  lfC++++  lC++C +  H 
  LOC_Os02g43170.2 62 APLCDICQEKRGFLFCKEDRAILCRECDVPVHT 94
                      689*************************99884 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.741147IPR000315B-box-type zinc finger
SMARTSM003368.5E-9147IPR000315B-box-type zinc finger
CDDcd000214.48E-5347No hitNo description
PfamPF006433.0E-5444IPR000315B-box-type zinc finger
PROSITE profilePS501199.68460107IPR000315B-box-type zinc finger
SMARTSM003364.1E-1160107IPR000315B-box-type zinc finger
PfamPF006431.6E-662102IPR000315B-box-type zinc finger
CDDcd000218.22E-76395No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MKVQCDVCAA EAASVFCCAD EAALCDACDH RVHRANKLAG KHRRFSLLNP SASGRSPTST  60
TAPLCDICQE KRGFLFCKED RAILCRECDV PVHTASELTM RHSRYLLTGV RLSSEPAASP  120
APPSEEENSS SFCCSADDAV PAPAAPATSH GGSSGSSSIS EYLTTLPGWH VEDFLVDDAT  180
AEAAAAAAAT SSGISANGPC QVGATDRP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.532360.0callus| flower| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6H630
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g43170.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g43170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8588190.0HQ858819.1 Oryza sativa Japonica Group isolate UT1236 ORPHANS transcription factor mRNA, partial cds.
GenBankAK0715070.0AK071507.1 Oryza sativa Japonica Group cDNA clone:J023090D24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623928.11e-144PREDICTED: B-box zinc finger protein 20
SwissprotQ9LQZ75e-54BBX21_ARATH; B-box zinc finger protein 21
TrEMBLQ6H6301e-144Q6H630_ORYSJ; ORPHANS transcription factor
STRINGLOC_Os02g43170.11e-143(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.13e-37salt tolerance homolog2