PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g43150.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GATA
Protein Properties Length: 425aa    MW: 44147.7 Da    PI: 8.1921
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g43150.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.12.8e-19350384135
              GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                       Cs+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  LOC_Os02g43150.2 350 CSHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 384
                       *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.61E-14344407No hitNo description
SMARTSM004017.4E-18344398IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308344380IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-15348382IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.86E-14349391No hitNo description
PROSITE patternPS003440350375IPR000679Zinc finger, GATA-type
PfamPF003203.0E-17350384IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 425 aa     Download sequence    Send to blast
MTHQALIPST PPSAFSPASH FLHASSSSSP SLSSHAVVAT AAAAMSSFAH HHHGSLVEKD  60
GRMSALRSSL RPYEAAEEMA AAAAAGGPAA AWGAVERGAG MMGDGFSVED LLDLEELCEV  120
DRDGGEQGEA AAAAAAAVEK ERSSDSHGSS VVSYEPMPLL PPVMDLPAHD VEELEWVSRI  180
MDDSLAELPL PQLPAAAAAL AACGKPQHRR PHEGAASALL DPMRTPTICA LSTEALVPVK  240
SRRSKRSRAS VWSLSGAPLS DSTSSSSTAT TSSCSSSASF SPFLQYVDFP ALVASDLLDE  300
QPRSKKSKHG KNGKQKPKKR GRKPKHQQPP HLAAAAGGGA ALPATGDRRC SHCGVQKTPQ  360
WRAGPEGAKT LCNACGVRYK SGRLLPEYRP ACSPTFVSSL HSNSHRKKET PVIVAAAAPA  420
VASF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.271820.0callus| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329946860.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g43150.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g43150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1094770.0AK109477.1 Oryza sativa Japonica Group cDNA clone:001-200-C09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623357.10.0PREDICTED: GATA transcription factor 6
TrEMBLA3A9J90.0A3A9J9_ORYSJ; Uncharacterized protein
STRINGLOC_Os02g43150.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-33GATA transcription factor 5