PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g42870.1
Common NameLOC4330121, OJ1112_G03.9, Os02g0641900, OSNPB_020641900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 301aa    MW: 32154.3 Da    PI: 7.4607
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g42870.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.5e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd+llvd+++  G g+W++ ++  g++R++k+c++rw +yl
  LOC_Os02g42870.1 14 KGPWTPEEDKLLVDYIQANGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T+eE++ +v+++   G++ W+ Ia+ ++ gRt++++k++w+++l
  LOC_Os02g42870.1  67 RGPFTAEEQKSIVQLHGIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 112
                       89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.259961IPR017930Myb domain
SuperFamilySSF466893.63E-3111108IPR009057Homeodomain-like
SMARTSM007173.7E-141363IPR001005SANT/Myb domain
PfamPF002492.0E-161461IPR001005SANT/Myb domain
CDDcd001671.40E-101661No hitNo description
PROSITE profilePS5129425.45762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2665116IPR009057Homeodomain-like
SMARTSM007173.1E-1466114IPR001005SANT/Myb domain
PfamPF002492.0E-1367112IPR001005SANT/Myb domain
CDDcd001672.49E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001059developmental stageJ bicellular pollen stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGRAPCCDKK GLKKGPWTPE EDKLLVDYIQ ANGHGSWRLL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGPF TAEEQKSIVQ LHGIVGNKWS MIAAQLPGRT DNEIKNYWNT HLKKQLRRMG  120
LDDPPPGPAA GCPAARHMAQ WETARLEAEA RLSLLSSSGA AATTTITAAT TTTSASSSST  180
TAGPVAAAAT SPADVFLRLW NSSIGDSFRK LAVVAAGSSS PSRADVTKDA VKQEEEAAPA  240
GDDSSAASNE VEAATMAVDE YQMFLDFAGE ELGLFHGRYG GFSLFPPVDL LEASLETAFK  300
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6H7S0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g42870.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g42870
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1086210.0AK108621.1 Oryza sativa Japonica Group cDNA clone:002-147-D04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624300.10.0PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0E0NIC90.0A0A0E0NIC9_ORYRU; Uncharacterized protein
TrEMBLQ6H7S00.0Q6H7S0_ORYSJ; Os02g0641900 protein
STRINGLOC_Os02g42870.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP54093157
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-78myb domain protein 17