PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g42850.2
Common NameLOC4330115, OJ1112_G03.5, OsJ_07687, P0010C01.48
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 318aa    MW: 34205.5 Da    PI: 5.1755
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g42850.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding483e-151562148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEd++l d++ ++G g+W++ ++  g+ R +k+c++rw +yl
  LOC_Os02g42850.2 15 KGLWSPEEDQKLRDYILRHGHGCWSALPANAGLQRNGKSCRLRWINYL 62
                      678*******************************************97 PP

2Myb_DNA-binding54.52.7e-1769113248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  LOC_Os02g42850.2  69 GVFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 113
                       789******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8911062IPR017930Myb domain
SuperFamilySSF466891.28E-2812109IPR009057Homeodomain-like
SMARTSM007176.1E-111464IPR001005SANT/Myb domain
PfamPF002491.6E-131562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-211669IPR009057Homeodomain-like
CDDcd001673.65E-101862No hitNo description
PROSITE profilePS5129425.60363117IPR017930Myb domain
SMARTSM007172.5E-1567115IPR001005SANT/Myb domain
PfamPF002491.2E-1569113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-2570117IPR009057Homeodomain-like
CDDcd001679.40E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGCKSCEKPR PNYRKGLWSP EEDQKLRDYI LRHGHGCWSA LPANAGLQRN GKSCRLRWIN  60
YLRPGLKHGV FSPEEEETVM SLHAALGNKW SRIARHLPGR TDNEVKNYWN SYLKKRVESG  120
GGKTSQGPPT TPASAASSPA DSDDSHSLQQ KPHEPANSDS SEPAHESSSA SADSSCLTVT  180
TDHPPVSRPH AAVTPKVMFA DWLDMEYICG QVAAAPGLDA AGFAVVGGAA GDQQQQQQQV  240
MSQDGSVHQA DGPSCGVDDS SLQQQQQEGF GGNGGCWDFQ EQFDSIDQMQ ASGGGGGFCD  300
LLSMSDFDLW AELERTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25111193110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.99710.0callus| flower| leaf| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6H7C6
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g42850.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g42850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU8372490.0EU837249.1 Oryza sativa Japonica Group clone KCS157B05 ATMYB4-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622999.10.0PREDICTED: transcription factor MYB21
TrEMBLA0A0E0NIC70.0A0A0E0NIC7_ORYRU; Uncharacterized protein
TrEMBLQ6H7C60.0Q6H7C6_ORYSJ; ATMYB4-like
STRINGLOC_Os02g42850.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.15e-57myb domain protein 19