PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g42850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 294aa    MW: 31173.4 Da    PI: 4.7563
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g42850.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.4e-174589248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  LOC_Os02g42850.1 45 GVFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 89
                      789******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-92450IPR009057Homeodomain-like
SuperFamilySSF466894.28E-222495IPR009057Homeodomain-like
PROSITE profilePS500904.0662538IPR017877Myb-like domain
PROSITE profilePS5129425.6033993IPR017930Myb domain
SMARTSM007172.5E-154391IPR001005SANT/Myb domain
PfamPF002491.0E-154589IPR001005SANT/Myb domain
CDDcd001675.85E-124789No hitNo description
Gene3DG3DSA:1.10.10.605.2E-225190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MCIVCCCLRA GLTRICPAIG AGLQRNGKSC RLRWINYLRP GLKHGVFSPE EEETVMSLHA  60
ALGNKWSRIA RHLPGRTDNE VKNYWNSYLK KRVESGGGKT SQGPPTTPAS AASSPADSDD  120
SHSLQQKPHE PANSDSSEPA HESSSASADS SCLTVTTDHP PVSRPHAAVT PKVMFADWLD  180
MEYICGQVAA APGLDAAGFA VVGGAAGDQQ QQQQQVMSQD GSVHQADGPS CGVDDSSLQQ  240
QQQEGFGGNG GCWDFQEQFD SIDQMQASGG GGGFCDLLSM SDFDLWAELE RTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-19259540110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.99710.0callus| flower| leaf| panicle| seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g42850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g42850
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8378400.0CT837840.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA108D17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622999.10.0PREDICTED: transcription factor MYB21
TrEMBLA0A0E0NIC70.0A0A0E0NIC7_ORYRU; Uncharacterized protein
TrEMBLQ6H7C60.0Q6H7C6_ORYSJ; ATMYB4-like
STRINGLOC_Os02g42850.20.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.14e-37myb domain protein 19