PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g41510.1
Common NameB1215B07.15, LOC4330027, Os02g0624300, OsJ_07582, OSNPB_020624300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 259aa    MW: 28468.8 Da    PI: 6.3123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g41510.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT+eEd +lv  ++++G  +W++ +r  g+ R++k+c++rw +yl
  LOC_Os02g41510.1 14 RGPWTAEEDRILVAHIERHGHSNWRALPRQAGLLRCGKSCRLRWINYL 61
                      89******************************99************97 PP

2Myb_DNA-binding49.41.1e-1567112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg++T eE++ +++++ +lG++ W++Ia++++ gRt++++k+ w+++l
  LOC_Os02g41510.1  67 RGNFTREEEDAIIHLHDLLGNR-WSAIAARLP-GRTDNEIKNVWHTHL 112
                       89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129415.902961IPR017930Myb domain
SuperFamilySSF466892.64E-3010108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001677.04E-111661No hitNo description
PROSITE profilePS5129425.75862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-2665116IPR009057Homeodomain-like
SMARTSM007175.1E-1466114IPR001005SANT/Myb domain
PfamPF002491.7E-1467112IPR001005SANT/Myb domain
CDDcd001672.38E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGRAPCCEKM GLKRGPWTAE EDRILVAHIE RHGHSNWRAL PRQAGLLRCG KSCRLRWINY  60
LRPDIKRGNF TREEEDAIIH LHDLLGNRWS AIAARLPGRT DNEIKNVWHT HLKKRLEPKP  120
SSGREAAAPK RKATKKAAAV AVAIDVPTTV PVSPEQSLST TTTSAATTEE YSYSMASSAD  180
HNTTDSFTSE EEFQIDDSFW SETLAMTVDS TDSGMEMSGG DPLGAGGASP SSSNDDDMDD  240
FWLKLFIQAG GMQNLPQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25121175109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.101720.0callus| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6K1S6
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00375DAPTransfer from AT3G23250Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g41510.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g41510
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1120560.0AK112056.1 Oryza sativa Japonica Group cDNA clone:001-110-C03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623124.10.0PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH41e-101MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A0E0NHZ20.0A0A0E0NHZ2_ORYRU; Uncharacterized protein
TrEMBLA2X7E40.0A2X7E4_ORYSI; Putative uncharacterized protein
TrEMBLI1P2C80.0I1P2C8_ORYGL; Uncharacterized protein
TrEMBLQ6K1S60.0Q6K1S6_ORYSJ; Os02g0624300 protein
STRINGBGIOSGA006005-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os02g41510.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0213400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.13e-77myb domain protein 15