PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g40530.1
Common NameLOC4330001, OJ1014_H03.26, OJ1212_C01.12, Os02g0618400, OsJ_07548, OSNPB_020618400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 290aa    MW: 32082.8 Da    PI: 5.2235
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g40530.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.51.8e-191764148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT++Ed+llv++v+q+G g+W+++a+  g++R++k+c++rw +yl
  LOC_Os02g40530.1 17 KGPWTAQEDKLLVEYVRQHGEGRWNSVAKITGLKRSGKSCRLRWVNYL 64
                      79********************************************97 PP

2Myb_DNA-binding50.93.5e-1670114147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  LOC_Os02g40530.1  70 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                       8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5421264IPR017930Myb domain
SuperFamilySSF466892.13E-3015111IPR009057Homeodomain-like
SMARTSM007177.4E-171666IPR001005SANT/Myb domain
PfamPF002492.5E-181764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-241871IPR009057Homeodomain-like
CDDcd001676.41E-131964No hitNo description
PROSITE profilePS5129424.93365119IPR017930Myb domain
SMARTSM007174.5E-1569117IPR001005SANT/Myb domain
PfamPF002496.3E-1470114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2472117IPR009057Homeodomain-like
CDDcd001673.03E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MEGQQFAWGR EEGGWRKGPW TAQEDKLLVE YVRQHGEGRW NSVAKITGLK RSGKSCRLRW  60
VNYLRPDLKR GKITPQEESV ILELHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  120
SKNIERARAR FLKQRREMQQ QSQLMQTGQQ QQLGQDDDAT SAVVDDNLAE VAPPAATSLT  180
HDGELQIMQE MAPDMDDLLY YHPGDMSPYS YDDLLGSGGG ECGAVAASAG AAASTSEGSS  240
EELDGGAATW GSLWNLDDVV HDMMIDCAAG AGCCWGSFPP LQDKGLAFY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26171177106B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.498290.0callus| flower| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884700.0
Expression AtlasQ6K949-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g40530.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g40530
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1118070.0AK111807.1 Oryza sativa Japonica Group cDNA clone:J013104N22, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624171.10.0PREDICTED: transcription factor MYB57
TrEMBLQ6K9490.0Q6K949_ORYSJ; Os02g0618400 protein
STRINGLOC_Os02g40530.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.13e-67myb domain protein 79