PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g39360.1
Common NameLOC4329923, OJ1058_F07.25, Os02g0606200, OSJNBa0030C08.1, OSNPB_020606200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family DBB
Protein Properties Length: 272aa    MW: 29148.4 Da    PI: 4.7381
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g39360.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.45.4e-07446541
          zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                       C+ +e+  +   C  ++  lC+ C +e H        H++ p
  LOC_Os02g39360.1  4 QCDACESAAAAVVCCADEAALCAACDVEVHAAnklagkHQRLP 46
                      7*******9*********************6678888888877 PP

2zf-B_box26.99.9e-095485334
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                       ++C+ ++ek + +fC +++ l+C+dC + +H
  LOC_Os02g39360.1 54 LPRCDVCQEKAAFIFCVEDRALFCRDCDEPIH 85
                      689**************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.025147IPR000315B-box-type zinc finger
PfamPF006432.6E-5447IPR000315B-box-type zinc finger
SMARTSM003369.5E-9447IPR000315B-box-type zinc finger
PROSITE profilePS501198.9025299IPR000315B-box-type zinc finger
SMARTSM003364.6E-145299IPR000315B-box-type zinc finger
PfamPF006431.8E-65495IPR000315B-box-type zinc finger
CDDcd000212.21E-75585No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010100Biological Processnegative regulation of photomorphogenesis
GO:0005634Cellular Componentnucleus
GO:0000989Molecular Functiontranscription factor activity, transcription factor binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MKIQCDACES AAAAVVCCAD EAALCAACDV EVHAANKLAG KHQRLPLEAL SARLPRCDVC  60
QEKAAFIFCV EDRALFCRDC DEPIHVPGTL SGNHQRYLAT GIRVGFASAS PCDGGSDAHD  120
SDHHAPPMGS SEHHHHHQQP APTVAVDTPS PQFLPQGWAV DELLQFSDYE TGDKLQKESS  180
PPLGFQELEW FADIDLFHNQ APKGGAAAGR TTAEVPELFA SQAANDVAYY RPPTRTAAAA  240
FTAATGFRQS KKARVELPDD EEDYLIVPDL G*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33970.0callus| leaf| panicle| root| seed| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasO82115
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g39360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g39360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0018850.0AB001885.1 Oryza sativa Japonica Group mRNA for zinc finger protein, complete cds, clone:R1577.
GenBankAK1042930.0AK104293.1 Oryza sativa Japonica Group cDNA clone:001-007-G06, full insert sequence.
GenBankAK0610440.0AK061044.1 Oryza sativa Japonica Group cDNA clone:006-205-E01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626533.10.0PREDICTED: B-box zinc finger protein 25
TrEMBLO821150.0O82115_ORYSJ; ORPHAN transcription factor
STRINGLOC_Os02g39360.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP53971020
MonocotsOGMP32023368
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06040.18e-49DBB family protein
Publications ? help Back to Top
  1. Song J, et al.
    Isolation and mapping of a family of putative zinc-finger protein cDNAs from rice.
    DNA Res., 1998. 5(2): p. 95-101
    [PMID:9679197]