PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g38470.1
Common NameLOC4329874, OJ1212_D02.14, Os02g0598200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family B3
Protein Properties Length: 1049aa    MW: 118379 Da    PI: 9.3334
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g38470.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B332.21.8e-1098310423395
                        -SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                B3   33 sktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95  
                           ++l+d+  r W v +    k+  + +t+GWk F+ an+L++gD++ F  +  +e el ++
  LOC_Os02g38470.1  983 RNVVILKDPMRRLWPVFY--HDKPVFVGFTAGWKPFAAANNLQAGDVCKFVKEM-DEDELAFQ 1042
                        34799*************..9***9*************************9443.44444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.489375468IPR003340B3 DNA binding domain
SuperFamilySSF1019361.92E-16377470IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.0E-4378468IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.9E-14378468IPR015300DNA-binding pseudobarrel domain
CDDcd100173.23E-7390465No hitNo description
SMARTSM010190.00469551047IPR003340B3 DNA binding domain
SuperFamilySSF1019361.59E-139561047IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.2E-139561047IPR015300DNA-binding pseudobarrel domain
CDDcd100172.32E-149611047No hitNo description
PfamPF023629.4E-89651044IPR003340B3 DNA binding domain
PROSITE profilePS5086310.2789861048IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 1049 aa     Download sequence    Send to blast
MDGAVRGQGC VGRLRSFNKT KKKNRNCSDD MRNGDDEEKK YSHHDMKNNL RNDANEEKRK  60
SSDDMRDGDF EEKKKCSRHD MKKNLRNDAN EEKRKSSDDM RDGDDEEKKC SRQDMKKNLR  120
NDADEEKRKS SDDMRDGDDE EKKKRSRHDM KKNSRNDADE EKRKRKRKCS DDLKKSVVND  180
ASKEATSHSD WRKNRKAGSD AEQRGKKLLN GDKKAKSRKV TTPFFEKMRK IKMQRTSNQN  240
GEKNMKSDGD SYKKTVPLSV NKGKMEKDGT NKRTLSNTLV AKERKMRPSD SMEMKMKKKK  300
RDASFVQPDE RTAQTFSTKN KEKKRKAPST PLKREQKERV ASSDNKKETK KACIVAIGNE  360
KKNCRDGKKK KRKAAFAFFK FVRDEFEELL FIPPAVAPSL KDLIDRHVYL EDSEGKCSKI  420
RLSVVDGSLA FYEGWNSFVS EHCIKWGEFL LFEYTPESTF SVRVFGIDSC ERLHFSVKSG  480
GKGAVKKRKE RHTLSDDLIS HYNGQYQDSE DIHDGPNVSG ESPRSKEPKI TVDAEIGTRN  540
LVAKSINAAS ETQDSERVES GIGYGSLGAL GNKVRNLSNG ECDTRSDSVF CIQEKTRRSE  600
VIIISDEAYS TQVDEDTMKQ TAPSEASEIH HVTINTQKDL ERVVDGVCCE SSVALNNKMG  660
NLILGEPKNK NISPACSTEK TNGSEITPTT GVIPLTQENI DTVKLNTLSC FEEDRSTTRE  720
SELAAAIPTT SETHDSDKDL GQKHQRNSVQ VNSIIAVDKY PNDSEMNISG NIFRIYEAPA  780
GTRCLEKWKR GIVNGRAALD DIGQVRPEKT QKAGEKLVGN CGAMGESPVD LRIESDVTDT  840
CLKPILNIPI EELSILDSVS ISKCGRSRTE VNHLFNQKGA TVQLQTKKEP LKPTGSSGNR  900
KGDKIAVSVN RVFAHQSELQ IPQQENGNFT SCVTPVALLP AKAELLDLDD HSLQFCIPST  960
IQKWLELPKS LPITCRQKGR YDRNVVILKD PMRRLWPVFY HDKPVFVGFT AGWKPFAAAN  1020
NLQAGDVCKF VKEMDEDELA FQVYITRK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142164KKRSRHDMKKNSRNDADEEKRKR
2161167KRKRKRK
3162167RKRKRK
4367372KKKKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.505930.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379916130.0
Expression AtlasQ6K5K2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g38470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g38470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1219900.0AK121990.1 Oryza sativa Japonica Group cDNA clone:J033109I02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624189.10.0PREDICTED: B3 domain-containing protein Os02g0598200
RefseqXP_015624190.10.0PREDICTED: B3 domain-containing protein Os02g0598200
SwissprotQ6K5K20.0Y2982_ORYSJ; B3 domain-containing protein Os02g0598200
TrEMBLA3A8P40.0A3A8P4_ORYSJ; Uncharacterized protein
STRINGLOC_Os02g38470.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1458744
MonocotsOGMP122722730
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18960.12e-11B3 family protein