PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g36924.1
Common NameB1267B06.20, LOC4329771, MADS27, Os02g0579600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27422.1 Da    PI: 9.4759
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g36924.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.14.9e-281059251
                      ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyeyss
  LOC_Os02g36924.1 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSS 59
                      8***********************************************96 PP

2K-box94.61.6e-3175170398
             K-box   3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                       +++ +++ +++ + +q+e+a L+++++nLq+++R+l+GedL+ L++keLq+Le+qLe sl+++R+kK+++l+++i+el +k   +++en++L 
  LOC_Os02g36924.1  75 EQQAVANPNSELKFWQREAASLRQQLHNLQENHRQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELY 167
                       56777789999********************************************************************************** PP

             K-box  96 kkl 98 
                       kk+
  LOC_Os02g36924.1 168 KKI 170
                       *98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.2E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-32291IPR002100Transcription factor, MADS-box
CDDcd002651.99E-44277No hitNo description
PRINTSPR004041.6E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-273859IPR002100Transcription factor, MADS-box
PfamPF014869.1E-3083170IPR002487Transcription factor, K-box
PROSITE profilePS5129716.39486176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010440Biological Processstomatal lineage progression
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0042803Molecular Functionprotein homodimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TGRLYEYSST  60
SMKSVIDRYG KSKDEQQAVA NPNSELKFWQ REAASLRQQL HNLQENHRQL MGEDLSGLNV  120
KELQSLENQL EISLRSVRTK KDHVLIDEIH ELNRKGSLVH QENMELYKKI SLIRQENAEL  180
YKKIYETEGP SEVNRDSPTP YNFAVIEKTN VPVQLGLSTL PQHSDAEQST APKLGLQLNP  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S1e-19183183Myocyte-specific enhancer factor 2B
1tqe_R1e-19183183Myocyte-specific enhancer factor 2B
1tqe_Q1e-19183183Myocyte-specific enhancer factor 2B
1tqe_P1e-19183183Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497620.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166386740.0
Expression AtlasQ6EP49-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:14701936}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00410DAPTransfer from AT3G57230Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g36924.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g36924
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1776960.0AY177696.1 Oryza sativa (japonica cultivar-group) transcription factor MADS27 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626695.11e-178PREDICTED: MADS-box transcription factor 27
SwissprotQ6EP491e-180MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0D3F6V11e-174A0A0D3F6V1_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0CMG21e-174A0A0E0CMG2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NGW01e-174A0A0E0NGW0_ORYRU; Uncharacterized protein
TrEMBLB8AED31e-174B8AED3_ORYSI; Putative uncharacterized protein
TrEMBLB9F0Q91e-174B9F0Q9_ORYSJ; Uncharacterized protein
STRINGLOC_Os02g36924.11e-178(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.11e-102AGAMOUS-like 16
Publications ? help Back to Top
  1. Lee S, et al.
    Systematic reverse genetic screening of T-DNA tagged genes in rice for functional genomic analyses: MADS-box genes as a test case.
    Plant Cell Physiol., 2003. 44(12): p. 1403-11
    [PMID:14701936]