PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g36880.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 374aa    MW: 40254.5 Da    PI: 7.2026
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g36880.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1721.9e-53371631128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL +k+++    +++++ e+d++k+ePwdLp++++ +ekewyfF+ +d+ky+tg r+nrat+sgyWkatgkd+e++
  LOC_Os02g36880.4  37 LPPGFRFHPTDEELITHYLLRKAADPAGFAARAVGEADLNKCEPWDLPSRATMGEKEWYFFCVKDRKYPTGLRTNRATESGYWKATGKDREIF 129
                       79*********************9999666689***************988899*************************************** PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +++lvg+kktLvfy+grap+g kt Wvmheyr+
  LOC_Os02g36880.4 130 R-GKALVGMKKTLVFYTGRAPRGGKTGWVMHEYRI 163
                       *.99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-6425185IPR003441NAC domain
PROSITE profilePS5100559.78337185IPR003441NAC domain
PfamPF023652.9E-2938163IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MRLARQQQQV VVAATMEHDV HHHRQMMQQQ QQQEMDLPPG FRFHPTDEEL ITHYLLRKAA  60
DPAGFAARAV GEADLNKCEP WDLPSRATMG EKEWYFFCVK DRKYPTGLRT NRATESGYWK  120
ATGKDREIFR GKALVGMKKT LVFYTGRAPR GGKTGWVMHE YRIHGKHAAA NSKDQEWVLC  180
RVFKKSLELA PAAAAAVGRR GAGAGTDVGP SSMPMADDVV GLAPCALPPL MDVSGGGGGA  240
GTTSLSATAG AAAAPPPAHV TCFSNALEGQ FLDTPYLLPA ADPADHLAMS SASPFLEALQ  300
MQYVQDAAAA GGAGMVHELL MGGGWYCNKG ERERLSGASQ DTGLTSSEVN PGEISSSSRQ  360
QRMDHHDASL WAY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-55231853165NO APICAL MERISTEM PROTEIN
1ut4_B2e-55231853165NO APICAL MERISTEM PROTEIN
1ut7_A2e-55231853165NO APICAL MERISTEM PROTEIN
1ut7_B2e-55231853165NO APICAL MERISTEM PROTEIN
4dul_A2e-55231853165NAC domain-containing protein 19
4dul_B2e-55231853165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.94920.0callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166364330.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g36880.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g36880
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281800.0AB028180.1 Oryza sativa mRNA for OsNAC1 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623390.10.0PREDICTED: NAC domain-containing protein 92 isoform X2
SwissprotQ9FLJ21e-89NC100_ARATH; NAC domain-containing protein 100
TrEMBLB8AED20.0B8AED2_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA008492-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.13e-84NAC domain containing protein 100