PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g35770.1
Common NameHOX7, LOC4329705, Os02g0565600, P0020C11.33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 350aa    MW: 37437.6 Da    PI: 5.7163
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g35770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-18152206256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq   Le+ F+++++++ +++ +LA++l+L  rqV vWFqNrRa+ k
  LOC_Os02g35770.1 152 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTK 206
                       788899***********************************************98 PP

2HD-ZIP_I/II1261.7e-40152243192
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                       +kk+rlskeq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++ev+eLr +l+
  LOC_Os02g35770.1 152 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRCCERLTRENRRLQREVAELRGTLR 243
                       69**************************************************************************************8886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-18133206IPR009057Homeodomain-like
SuperFamilySSF466891.0E-17143209IPR009057Homeodomain-like
PROSITE profilePS5007117.135148208IPR001356Homeobox domain
SMARTSM003892.1E-16150212IPR001356Homeobox domain
CDDcd000866.45E-17152209No hitNo description
PfamPF000461.2E-15152206IPR001356Homeobox domain
PROSITE patternPS000270183206IPR017970Homeobox, conserved site
PfamPF021834.8E-11208242IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.3E-18208252IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MELELSLGDS PAPVKATIAP TPVLIPTCMG DEEDLELVLG VRATRRDEQD DQTTCTQSSE  60
EAMEGEEDET RPHGEAPVES LSFPLFVSSA ETGSANSEMC TRGFDVNTRP ADGGAEAGRP  120
SSPSSMQEAS TRQQVADQEA ADDEDNGGGG ARKKLRLSKE QSSFLEDSFK EHSTLTPKQK  180
SDLANRLNLR PRQVEVWFQN RRARTKLKQT EVDCEHLKRC CERLTRENRR LQREVAELRG  240
TLRTTTSSYP PLYGLHHLPA AAGTVFRVCP SCEHSKVVAA AASESFSPRV FAGGGAPAAI  300
TAAAAVPSPG AGSPPSSSAA LFGARRPHFG PFAAAVIPPV LRRQPSATS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200208RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.23620.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329741360.0
Expression AtlasQ0E0A6-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. {ECO:0000269|PubMed:10732669}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g35770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g35770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0641180.0AK064118.1 Oryza sativa Japonica Group cDNA clone:002-102-B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626174.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X1
SwissprotQ0E0A60.0HOX7_ORYSJ; Homeobox-leucine zipper protein HOX7
TrEMBLA0A0E0NGK10.0A0A0E0NGK1_ORYRU; Uncharacterized protein
STRINGLOC_Os02g35770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP128943035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-53homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Meijer AH,de Kam RJ,d'Erfurth I,Shen W,Hoge JH
    HD-Zip proteins of families I and II from rice: interactions and functional properties.
    Mol. Gen. Genet., 2000. 263(1): p. 12-21
    [PMID:10732669]
  2. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]