PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g35140.1
Common NameARF7, LOC4329672, Os02g0557200, OsJ_07141, OSJNBb0038F20.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARF
Protein Properties Length: 679aa    MW: 74787.1 Da    PI: 6.3855
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g35140.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.42.7e-23128228198
                       EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                       f+k+lt sd++++g +++ +++aee+       ++++ +  +l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   +
  LOC_Os02g35140.1 128 FCKTLTASDTSTHGGFSVLRRHAEEClppldmtQNPPWQ--ELVARDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFL--R 216
                       99****************************986555545..8************************************************..4 PP

                       SSEE..EEEEE- CS
                B3  87 rsefelvvkvfr 98 
                        +++el+v+v+r
  LOC_Os02g35140.1 217 GENGELRVGVRR 228
                       49999*****97 PP

2Auxin_resp111.49e-37254336183
        Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                       a+ha+st++ F+v+Y+Pr+s+seFvv+++k+++a ++k+svGmRfkm+fe+++++err+sGt++gv  ++++ W nS WrsLk
  LOC_Os02g35140.1 254 ASHAISTGTLFSVFYKPRTSQSEFVVSANKYLEAKNSKISVGMRFKMRFEGDEAPERRFSGTIIGVGSMSTSPWANSDWRSLK 336
                       789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.58E-44117257IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.6E-41123243IPR015300DNA-binding pseudobarrel domain
CDDcd100177.75E-22126228No hitNo description
PfamPF023625.4E-21128228IPR003340B3 DNA binding domain
PROSITE profilePS5086311.462128230IPR003340B3 DNA binding domain
SMARTSM010191.5E-22128230IPR003340B3 DNA binding domain
PfamPF065071.9E-34254336IPR010525Auxin response factor
PfamPF023099.9E-13535639IPR033389AUX/IAA domain
PROSITE profilePS5174525.456548641IPR000270PB1 domain
SuperFamilySSF542776.54E-12550627No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MAGSVVAAAA AAGGGTGSSC DALYRELWHA CAGPLVTVPR QGELVYYFPQ GHMEQLEAST  60
DQQLDQHLPL FNLPSKILCK VVNVELRAET DSDEVYAQIM LQPEADQNEL TSPKPEPHEP  120
EKCNVHSFCK TLTASDTSTH GGFSVLRRHA EECLPPLDMT QNPPWQELVA RDLHGNEWHF  180
RHIFRGQPRR HLLTTGWSVF VSSKRLVAGD AFIFLRGENG ELRVGVRRLM RQLNNMPSSV  240
ISSHSMHLGV LATASHAIST GTLFSVFYKP RTSQSEFVVS ANKYLEAKNS KISVGMRFKM  300
RFEGDEAPER RFSGTIIGVG SMSTSPWANS DWRSLKVQWD EPSVVPRPDR VSPWELEPLA  360
VSNSQPSPQP PARNKRARPP ASNSIAPELP PVFGLWKSSA ESTQGFSFSG LQRTQELYPS  420
SPNPIFSTSL NVGFSTKNEP SALSNKHFYW PMRETRANSY SASISKVPSE KKQEPSSAGC  480
RLFGIEISSA VEATSPLAAV SGVGQDQPAA SVDAESDQLS QPSHANKSDA PAASSEPSPH  540
ETQSRQVRSC TKVIMQGMAV GRAVDLTRLH GYDDLRCKLE EMFDIQGELS ASLKKWKVVY  600
TDDEDDMMLV GDDPWPEFCS MVKRIYIYTY EEAKQLTPKS KLPIIGDAIK PNPNKQSPES  660
DMPHSDLDST APVTDKDC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.053591355Auxin response factor 1
4ldw_A0.053591355Auxin response factor 1
4ldw_B0.053591355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.592730.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154467140.0
Expression AtlasQ6YVY0-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Function -- GeneRIF ? help Back to Top
  1. the OsARF1 was shown to be essential for growth in vegetative organs and seed development
    [PMID: 19193962]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g35140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g35140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0700260.0AK070026.1 Oryza sativa Japonica Group cDNA clone:J023036G16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625501.10.0PREDICTED: auxin response factor 7
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLA0A0E0NGE40.0A0A0E0NGE4_ORYRU; Auxin response factor
STRINGLOC_Os02g35140.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5501582
MonocotsOGMP108236116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1
Publications ? help Back to Top
  1. Wang D, et al.
    Genome-wide analysis of the auxin response factors (ARF) gene family in rice (Oryza sativa).
    Gene, 2007. 394(1-2): p. 13-24
    [PMID:17408882]
  2. Attia KA, et al.
    Antisense phenotypes reveal a functional expression of OsARF1, an auxin response factor, in transgenic rice.
    Curr Issues Mol Biol, 2009. 11 Suppl 1: p. i29-34
    [PMID:19193962]