PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g34970.1
Common NameLOC4329655, Os02g0555300, OsJ_07126, OSNPB_020555300, P0470G10.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 205aa    MW: 22802.5 Da    PI: 6.7308
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g34970.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM104.31.5e-3271241128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGf+F P+deelvv++L++kv+  +++  ++i+++  ++++Pw+L+ k+ +  ++wyfF++  +        +r+ ++g W+  g d++v 
  LOC_Os02g34970.1   7 LPPGFHFFPSDEELVVHFLRRKVSLLPCHP-DIIPTLLPHRYNPWELNGKALQAGNQWYFFCHLTQ--------SRTSSNGHWSPIGVDETVR 90 
                       79*************************999.89**************966667789******9855........577789************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s +g++vglkktL f  g+ ++g +t+W+mhey+l
  LOC_Os02g34970.1  91 S-GGRNVGLKKTLLFSIGEPSEGIRTNWIMHEYHL 124
                       9.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.15E-454167IPR003441NAC domain
PROSITE profilePS5100540.57168IPR003441NAC domain
PfamPF023651.5E-208124IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MGGATNLPPG FHFFPSDEEL VVHFLRRKVS LLPCHPDIIP TLLPHRYNPW ELNGKALQAG  60
NQWYFFCHLT QSRTSSNGHW SPIGVDETVR SGGRNVGLKK TLLFSIGEPS EGIRTNWIMH  120
EYHLLDGDCV AGGSSNLTSS SSNRRSHRKR GHSSMESNNW VLCRVFESSC GSQVSFHGEG  180
TELSCLDEVF LSLDDYDEVS LPNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-33617319173NAC domain-containing protein 19
3swp_C5e-33617319173NAC domain-containing protein 19
3swp_B5e-33617319173NAC domain-containing protein 19
3swp_A5e-33617319173NAC domain-containing protein 19
3swm_D5e-33617319173NAC domain-containing protein 19
3swm_C5e-33617319173NAC domain-containing protein 19
3swm_B5e-33617319173NAC domain-containing protein 19
3swm_A5e-33617319173NAC domain-containing protein 19
4dul_B6e-33617316170NAC domain-containing protein 19
4dul_A6e-33617316170NAC domain-containing protein 19
1ut7_B6e-33617316170NO APICAL MERISTEM PROTEIN
1ut7_A6e-33617316170NO APICAL MERISTEM PROTEIN
1ut4_B6e-33617316170NO APICAL MERISTEM PROTEIN
1ut4_A6e-33617316170NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1166311950.0
Expression AtlasQ69ST3-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g34970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g34970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084540.0AK108454.1 Oryza sativa Japonica Group cDNA clone:002-143-C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626053.11e-151PREDICTED: NAC transcription factor 29
SwissprotQ8GWK69e-63NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A0E0NGD11e-151A0A0E0NGD1_ORYRU; Uncharacterized protein
TrEMBLB8AJG11e-151B8AJG1_ORYSI; Putative uncharacterized protein
TrEMBLQ69ST31e-151Q69ST3_ORYSJ; Os02g0555300 protein
STRINGBGIOSGA008422-PA1e-150(Oryza sativa Indica Group)
STRINGLOC_Os02g34970.11e-150(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP45101024
MonocotsOGMP36673679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.13e-62xylem NAC domain 1