PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g34590.1
Common NameOsJ_07098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 700aa    MW: 79693 Da    PI: 6.72
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g34590.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR170.53.9e-22105191290
              FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                        Y++Y++++GFs+rk k+++ + +++i ++++ Cskeg +e e+ +  +++ + ++trt+Cka+++ + +++g+w+v++l+++HnH+la
  LOC_Os02g34590.1 105 LYCDYGHRMGFSIRKGKQSYFTGTKRIRTKDYFCSKEGLKEGERLT--DANFNDPHTRTNCKAMVRFRVNNHGEWKVIRLVSDHNHNLA 191
                       7***************************************999877..9999***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-19105191IPR004330FAR1 DNA binding domain
PfamPF105518.7E-29287381IPR018289MULE transposase domain
PROSITE profilePS509669.446568606IPR007527Zinc finger, SWIM-type
PfamPF044348.0E-4579603IPR007527Zinc finger, SWIM-type
SMARTSM005750.0038581608IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 700 aa     Download sequence    Send to blast
MVNTDGEGGC EGGGGDPMCV DDNAIVAVET GVGVDQGIGS QHDDAGGDRV MEGQGAVTNS  60
GDEMGMRAYG DEAETEEAAT VHGSKEGTEE LLRKVVYSEE AAYKLYCDYG HRMGFSIRKG  120
KQSYFTGTKR IRTKDYFCSK EGLKEGERLT DANFNDPHTR TNCKAMVRFR VNNHGEWKVI  180
RLVSDHNHNL ARPEERHLLR SARSLIAGRS SSVETSKQDS LSCYISMART LAIGNADLQN  240
LVRHLKSRAN EDGMFYWDVQ IDRGGRMTNF FWRDGRSRID FDCFGDVVVF DATYRLNKHN  300
LICAPFVGVN HHWQNTMYGC ALLADESMSS FVWLFKSFLE AMGNRHPRSI FTNQDQVMSK  360
AIEEVFPNTC HRISRWHIQK NAASRLGTLN GSKAFNKLFT KCMQGCDSEA EFEETWAGML  420
REFKLEDNKW LKKLYKLKQK WCGALNKHTF DGGVEYEPQC DSLSNIFNCI AEKFTSPSTI  480
VVVVDKLTED WREKEIDEDT RCSQKPPACI IKHSDILNHA AKVYTYRIYK LFETYFLDGC  540
GATKFKELHC EDNNRYQFEM TMQGRGSRVC TVHFDMMTMQ LNCSCSKFET MGLLCPHALK  600
ALSIKNVCSI PETYILKRWT KGAKKCVFNP KQYESSYQEC MDDEAAYCSH VMRYAYDLVT  660
KSQGNEELRK SLWETLESGE KELEKYLENV TQYALSYAT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.115670.0callus| leaf| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329880160.0
Expression AtlasB9F0H6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g34590.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g34590
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0047750.0AP004775.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0451A10.
GenBankAP0040380.0AP004038.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1004_H01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626433.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLB9F0H60.0B9F0H6_ORYSJ; Uncharacterized protein
STRINGLOC_Os02g34590.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1457144
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-76FAR1-related sequence 5