PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g33560.1
Common NameLOC4329583, Os02g0538900, OSJNBa0014M17.21, OSNPB_020538900, P0508B05.42
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 327aa    MW: 35245.6 Da    PI: 7.7028
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g33560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_120.78.8e-071902391463
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  14 ReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       R + +rsR RK+++i+ Le+ v++L++   +L+ ++ +l ++  +l +e+
  LOC_Os02g33560.1 190 RRSGQRSRVRKLQYIADLERTVDSLQNIGADLAVRVASLFQLRNALSMEN 239
                       67889***************************999999999999998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147036.74E-16189233No hitNo description
Gene3DG3DSA:1.20.5.1706.4E-7190251No hitNo description
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MSRSPHLPPR CPPLGPQITR RDDSLFTQSC RFPSEDPFVG EPPCWLDDLL ADSGKSHTLP  60
PLRRACSDSD AILDVLTSFQ SPIYPIDEGD PQPVGEAGES FNAAAEGGGS GAGIEGSCVY  120
GPNSPRQKTR LTSSESSMVN AVLENVPSNP LQYLMIDATS GVNCNVGAAN GTGDTGDAVC  180
HADQEKSLKR RSGQRSRVRK LQYIADLERT VDSLQNIGAD LAVRVASLFQ LRNALSMENK  240
QLRRQITSLQ QAKLIKDGQT QMLKKETERL KQLSVRHRRS RSVTSCFEAN SFGGGDPSAI  300
NWQMLDMSKL SLNGGAVVPP RGGYGM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195RRSGQRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.496600.0callus| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ER85
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g33560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g33560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ3248080.0HQ324808.1 Oryza sativa Japonica Group clone KCS608G03 b-zip protein mRNA, complete cds.
GenBankAK0636440.0AK063644.1 Oryza sativa Japonica Group cDNA clone:001-118-H05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623493.10.0PREDICTED: basic leucine zipper 34
TrEMBLQ6ER850.0Q6ER85_ORYSJ; B-zip protein
STRINGLOC_Os02g33560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP973745
MonocotsOGMP81372631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.25e-18bZIP family protein