PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g28180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
Protein Properties Length: 493aa    MW: 55918.2 Da    PI: 4.8989
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g28180.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR128.93.7e-09102142142
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkre 42 
                       +fYn+YA++vGFsvrk + +++  +g+  ++ +vCs+eg +e
  LOC_Os02g28180.1 102 NFYNSYARRVGFSVRKCHVNYR-ADGTLSSKYMVCSNEGGDE 142
                       6****************99987.8999***********9776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.4E-6102142IPR004330FAR1 DNA binding domain
PfamPF105511.0E-30218312IPR018289MULE transposase domain
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MDERGVGDEP VLMGEVQQVG ESNPTLSEAS QRTGFTFNSV GHHAMGESSN CNLEGHNVVF  60
RSDREKSEQV TQSNIKATNQ NAPCEQVPKV GMTFQSEDDA YNFYNSYARR VGFSVRKCHV  120
NYRADGTLSS KYMVCSNEGG DENVPFLQMD CNNFIGRERK KYLETQDAQT LLEYLDNKQA  180
EDPSFFYSVQ LDKEDGRICN FFWTDGQAIA DYACFGDVLS IDTTFQTNKS EMPFTPIIGA  240
NHHRQTIIFG AALLFDESAD SFVWLFRNFL KAMSGKQPET IFTDQCAAMA KAIMIVFLNS  300
SHCLCLWHIY QNAAKHLSHV ISNNPNFLHD FKRCVYEERS VAHFNFNWQK LISDYHLEDN  360
SWIQNLYDLR EKWATIQKVV TVDHSKDETR VTFNSVDMNI SCSCRKYTCL GEETTQPSNI  420
NIAGASQPTV QEPLDSNIVM PFGDISRMFV PPIRGEFTNL LFQAHHETTA AASASWRLEF  480
ENQDPNSSTS YD*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.233021e-119leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977221661e-119
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g28180.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g28180
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0058200.0AP005820.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0091C16.
GenBankAP0043020.0AP004302.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1122_H01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624965.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 3-like
TrEMBLM0Z9Y61e-115M0Z9Y6_HORVD; Uncharacterized protein
STRINGLOC_Os02g28180.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.15e-60FAR1-related sequence 5