PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g23823.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 77aa    MW: 8462.28 Da    PI: 8.5175
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g23823.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH22.71.8e-074069130
                      CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC CS
               HLH  1 rrrahnerErrRRdriNsafeeLrellPka 30
                      r++ +  rE+ RRdr+N+ f+eL + l ++
  LOC_Os02g23823.3 40 RKVQKADREKMRRDRLNEQFQELGSTLGNC 69
                      5778899****************9988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474598.87E-73173IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS508889.0453976IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.108.6E-63971IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.1E-54069IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MDPRSSQAQE DGFFHPRDGA CPADSSGKTE CKTQGSIATR KVQKADREKM RRDRLNEQFQ  60
ELGSTLGNCR NSAWSG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.799471e-124panicle
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g23823.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g23823
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8588501e-107HQ858850.1 Oryza sativa Japonica Group isolate UT1613 bHLH transcription factor mRNA, partial cds.
GenBankAK1039861e-107AK103986.1 Oryza sativa Japonica Group cDNA clone:001-017-H10, full insert sequence.
GenBankAK0697901e-107AK069790.1 Oryza sativa Japonica Group cDNA clone:J023031O20, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626280.16e-41PREDICTED: transcription factor bHLH121 isoform X2
TrEMBLQ67U216e-41Q67U21_ORYSJ; BHLH transcription factor
STRINGLOC_Os02g23823.12e-40(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19860.23e-07bHLH family protein