PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g22020.1
Common NameLOC4329184, Os02g0325600, OSNPB_020325600, P0476C12.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 413aa    MW: 44579.2 Da    PI: 6.6338
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g22020.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32235290156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       kpr++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  LOC_Os02g22020.1 235 KPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 290
                       79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.508232292IPR017930Myb domain
SuperFamilySSF466892.51E-17233293IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28233293IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-27235290IPR006447Myb domain, plants
PfamPF002491.8E-6237288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MEVDHADRDG ARRRCREYLL ALEEERRKIQ VFQRELPLCF DLVTQTIEGM RSQMDAAGSE  60
ETVSDQGPPP VLEEFIPLKP SLSLSSSEEE STHADAAKSG KKEEAETSER HSSPPPPPPE  120
AKKVTPDWLQ SVQLWSQEEP QQPSSPSPTP TKDLPCKPVA LNARKAGGAF QPFEKEKRAE  180
LPASSTTAAA SSTVVGDSGD KPTDDDTEKH METDKDNDKD AKDKDKEGQS QPHRKPRRCW  240
APELHRRFLQ ALQQLGGSHV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSSTGQS  300
SAAAGVPAPP APQFVVVGSI WVPPPEYAAA AAAQQHVQLA AAGNNASGSA NPVYAPVAML  360
PAGLQPHSHR KQHQQQQQGQ RHSGSEGRRS GDAGDGSSSS PAVSSSSQTT SA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.519450.0callus| leaf
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329870180.0
Expression AtlasQ6Z869-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g22020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g22020
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1018090.0AK101809.1 Oryza sativa Japonica Group cDNA clone:J033066M05, full insert sequence.
GenBankAK0643550.0AK064355.1 Oryza sativa Japonica Group cDNA clone:002-108-B01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623779.10.0PREDICTED: two-component response regulator ORR22
TrEMBLA0A0D3F4H10.0A0A0D3F4H1_9ORYZ; Uncharacterized protein
TrEMBLA0A0D9YRE50.0A0A0D9YRE5_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0NDZ20.0A0A0E0NDZ2_ORYRU; Uncharacterized protein
TrEMBLI1NZW80.0I1NZW8_ORYGL; Uncharacterized protein
TrEMBLQ6Z8690.0Q6Z869_ORYSJ; Myb family transcription factor-like
STRINGLOC_Os02g22020.10.0(Oryza sativa Japonica Group)
STRINGORGLA02G0127400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54151221
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-57G2-like family protein