PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g21685.1
Common NameOSJNBa0073A18.35
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family GRAS
Protein Properties Length: 148aa    MW: 15305.1 Da    PI: 9.3995
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g21685.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS31.22.7e-1063116255
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55 
                       ++lL e+A a+++g++  a +lL+ l+  ++p+gd+ qRl+a+++ AL++ +  
  LOC_Os02g21685.1  63 RQLLSEAAAAIANGNHIVAASLLSALKLSVNPQGDAEQRLVAMMVAALSSCVGT 116
                       789**********************************************98866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS509858.5936147IPR005202Transcription factor GRAS
PfamPF035149.3E-863116IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MTSDWGDTIQ RLNSVTAASS PSLPLLTVVN NTALLARSPT NSSSSTASSS ASSSPPISAA  60
SSRQLLSEAA AAIANGNHIV AASLLSALKL SVNPQGDAEQ RLVAMMVAAL SSCVGTSPSQ  120
HLADLYIGVG RRRWSEDRER RKERLDS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.497021e-137callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379903981e-137
Expression AtlasQ6ER63-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g21685.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g21685
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0056120.0AP005612.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0073A18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623156.16e-47PREDICTED: scarecrow-like protein 8
TrEMBLQ6ER632e-97Q6ER63_ORYSJ; Scarecrow transcriptional regulator-like protein
STRINGLOC_Os02g21685.11e-98(Oryza sativa Japonica Group)