PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g17460.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 498aa    MW: 55190.4 Da    PI: 8.2742
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g17460.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.99.7e-145997241
               TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                      ++k+CnCk+s+Clk+YCeCfaa+++C+  C+C+ C Nk e
  LOC_Os02g17460.1 59 KRKHCNCKNSRCLKLYCECFAARVYCDG-CHCSPCGNKIE 97
                      789*************************.********976 PP

2TCR50.54.2e-16143182140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+C+ks+ClkkYCeCf+a+  Cs++C+C+dCkN e
  LOC_Os02g17460.1 143 KHNKGCHCRKSECLKKYCECFQANILCSKNCRCQDCKNFE 182
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.3E-135898IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.61859183IPR005172CRC domain
PfamPF036381.0E-106195IPR005172CRC domain
SMARTSM011147.6E-18143184IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.6E-12146181IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MPPVRSAPVA PPPPPPPPQQ KKPAVPVSRP WPMSFTPHPP PPPPPPKPAV EVKNASPKKR  60
KHCNCKNSRC LKLYCECFAA RVYCDGCHCS PCGNKIENEN IRKEAIETIL LRNPLAFQPK  120
IENSPNTVTV RKDNSEAIPP IPKHNKGCHC RKSECLKKYC ECFQANILCS KNCRCQDCKN  180
FEGSEERKAL VQMKNASDRN HIQEAANFAL NGATGSLGYK NSPVRRKKYQ ENSLGEQILS  240
EAQFQPTDHA DVSQLASSCT GFGGDIAINY QSKSSEMIYR SPLANTIPLI EVNDLVKNAL  300
VACRKAPEAF LTKAGNKVEM QAEKQYQTND EINNDKTKEQ NLKEASLKDI QNKACIDRQN  360
INGTEPHLAN SFKDSRPASP GTQALMCDEM DTTFGNEDYR SPFVVPSRDQ DISELNADQE  420
RIVLTGLRDY LRVLITRGNI NATKFSLETA MELDSRRHHG ATTVFSQDKS MSSSCPETLG  480
NNQTSMSNDE QKEKSGG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g17460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g17460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0047710.0AP004771.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0413A11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623618.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_015623619.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLI1NZC70.0I1NZC7_ORYGL; Uncharacterized protein
STRINGLOC_Os02g17460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
MonocotsOGMP57552653
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.17e-84Tesmin/TSO1-like CXC domain-containing protein