PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g17190.1
Common NameLOC4328985, Os02g0271900, OSNPB_020271900, P0521F09.8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 471aa    MW: 51199.4 Da    PI: 8.2716
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g17190.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.56.2e-082301645
                      HHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding 16 vkqlGggtWktIartmgkgRtlkqcksrwq 45
                      ++ +G ++W+t+ar ++ gR + qc+ rw 
  LOC_Os02g17190.1  2 INIYGHNNWETVARAIP-GRNAQQCRVRWK 30
                      5789*************.***********6 PP

2Myb_DNA-binding33.11.3e-103981145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                      +++W+ eE+++l+++ + +G++ W + a+++  gRt   +k++w+
  LOC_Os02g17190.1 39 KQAWSREEELRLIHVQQIFGNK-WCRMAEHFT-GRTSAAIKEHWR 81
                      799*******************.********9.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.998133IPR017930Myb domain
CDDcd001672.87E-7133No hitNo description
SMARTSM007174.5135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-12242IPR009057Homeodomain-like
PfamPF139212.6E-9550No hitNo description
SuperFamilySSF466892.06E-201389IPR009057Homeodomain-like
PROSITE profilePS5129418.2233488IPR017930Myb domain
SMARTSM007174.1E-93886IPR001005SANT/Myb domain
CDDcd001671.08E-84181No hitNo description
Gene3DG3DSA:1.10.10.602.9E-154389IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MINIYGHNNW ETVARAIPGR NAQQCRVRWK FNLDPAISKQ AWSREEELRL IHVQQIFGNK  60
WCRMAEHFTG RTSAAIKEHW RGPMKRKLNS YLASGLLKKS PGLPENLSVS QSSDSNILQQ  120
CDVSSDENKL LSDLRPSLKS KEGVSSKCDG SSSDNQLLSD LRASLKSKGA SSKCDGSSGD  180
NQLLSDLRAS LKSKGASSKC DGSSGDNQLL SDLRASLKSK GASSKCDGSS DENKLLSDLR  240
ACLKSKQGAS SKCDGSSGEN QLLSDLQASL MSKQRTSSKY KQGASSKYKQ GASSKSKQGT  300
SSKSKQGFID LCENTDTSEG ESSELICTER PDPDSGEASQ RIRDRLNWRK RARKKLVFLS  360
SPVELKVSAV AESERHLQES KEMSPEVNIV SPPAVLQGFS PEVPSVCEKI VEPPLADFNQ  420
AKNVCSLETS SDPCTLEQHL ANVSDLLDMS YIDGLMIIPP SGCPYDGDFI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-1819021110B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.486210.0flower| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379905360.0
Expression AtlasQ6ESU2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g17190.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g17190
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1209130.0AK120913.1 Oryza sativa Japonica Group cDNA clone:J023034G08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622738.10.0PREDICTED: myb-like protein Q
TrEMBLQ6ESU20.0Q6ESU2_ORYSJ; Os02g0271900 protein
STRINGLOC_Os02g17190.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1295045
MonocotsOGMP165241011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-30myb domain protein 3r-4