PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g15350.1
Common NameLOC4328903, Os02g0252400, OSJNBa0009N02.17, OSNPB_020252400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 374aa    MW: 36843.3 Da    PI: 7.3082
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g15350.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof113.87.4e-3645101662
            zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         cprC+s +tkfCyynnys++qPryfC++CrryWt+GG+lrnvPvGgg+rk+k+ss
  LOC_Os02g15350.1  45 PCCPRCNSIKTKFCYYNNYSMAQPRYFCRECRRYWTQGGSLRNVPVGGGCRKSKRSS 101
                       569***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088428.0814599IPR003851Zinc finger, Dof-type
PfamPF027011.0E-304699IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-264799IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MASGGALSPV EEKPTVVKTT KAEQHEEEAA VAVKSAAEMM KKSSPCCPRC NSIKTKFCYY  60
NNYSMAQPRY FCRECRRYWT QGGSLRNVPV GGGCRKSKRS SASSASASAA SPPAPAVGAA  120
PPVVPALSSA ISKLLQSEPM AAPCADFPNV LPTFVSTGFE LPAAAGDRLS LGSFGAFGNL  180
SAAVAAPGGG GGSSTTTSFM DMLRGVGGLF DGVGNSHQMG GNGGGGGSYY APLITGAGNG  240
MLMPPPPLPP FSGSLMQHGM QGLFANHAMG GGGGGVMNAG EDGSVMAGLG GGQWPPALGG  300
ADEQQGGGDG GEAVMTKDTG GGASSSASRP DYFYGWNSAA GGVVAGGGIG GNAAAATGAT  360
PWQGLIDSSS AMM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41840.0flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO3092430640.0
Expression AtlasQ6K537-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g15350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g15350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0055100.0AP005510.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0009N02.
GenBankAB0281310.0AB028131.2 Oryza sativa Japonica Group mRNA for Dof zinc finger protein, complete cds, clone: OsDof-10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623741.10.0PREDICTED: dof zinc finger protein PBF
TrEMBLQ6K5370.0Q6K537_ORYSJ; Dof zinc finger protein
STRINGLOC_Os02g15350.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP173981010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.14e-29Dof family protein