PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g14910.1
Common NameBZIP19, LOC4328871, Os02g0247100, OSJNBa0090H18.24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 270aa    MW: 28175.8 Da    PI: 6.4055
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g14910.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.22.6e-11142188551
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                       kr +r   NR +A+rsR RK+++i eLe+ v +L+ e +aL  ++  
  LOC_Os02g14910.1 142 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQMEVSALSPRVAF 188
                       899**********************************9999877655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.1E-13138202IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.611140196IPR004827Basic-leucine zipper domain
PfamPF001707.7E-10142192IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-11142196No hitNo description
Gene3DG3DSA:1.20.5.1701.0E-13142196No hitNo description
CDDcd147032.71E-21143193No hitNo description
PROSITE patternPS000360145160IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAQLPPRAPS AAAAAGQEWS AMAAAGEFLG FAAARRGAHR RSASDSAAFL MEAAVPMDDV  60
IVGVGGGGEF DRLDDEQLMS MFSDVEAPAV SDGGGERGPA GEAHLMDMGD GDDGMGATSP  120
AGAGAMAAAA AAAAADGIAD PKRVKRILAN RQSAQRSRVR KLQYISELER SVTTLQMEVS  180
ALSPRVAFLD HQRSLLTVGN SHLKQRIAAL AQDKIFKDAH QEALKKEIER LRQVYHQQQI  240
KATGGADIAT AASMQAKHEL LACEGAAMR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.590881e-133leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6K3R9
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and shoots. {ECO:0000269|PubMed:18065552}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g14910.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By white light. {ECO:0000269|PubMed:18065552}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g14910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0056140.0AP005614.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0090H18.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622790.10.0PREDICTED: basic leucine zipper 19
SwissprotQ6K3R90.0BZP19_ORYSJ; Basic leucine zipper 19
TrEMBLA3A5180.0A3A518_ORYSJ; Uncharacterized protein
STRINGLOC_Os02g14910.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12617181
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.19e-58bZIP family protein
Publications ? help Back to Top
  1. Nijhawan A,Jain M,Tyagi AK,Khurana JP
    Genomic survey and gene expression analysis of the basic leucine zipper transcription factor family in rice.
    Plant Physiol., 2008. 146(2): p. 333-50
    [PMID:18065552]