PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g14490.1
Common NameLOC107275964, Os02g0241200, OsJ_06034, OSJNBa0082C09.24, OSNPB_020241200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 546aa    MW: 58907.1 Da    PI: 6.2531
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g14490.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.9e-31118171255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  LOC_Os02g14490.1 118 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 171
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.601114174IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.5E-29114172IPR009057Homeodomain-like
SuperFamilySSF466895.38E-14117172IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-22118173IPR006447Myb domain, plants
PfamPF002499.6E-9119170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
MKEKEVLVEI VEDDELKRSI GRNQLDLNEE VMDVESEEGE VGDDEDDEDE EDDDDDDDGG  60
STTDVAGSRS SSNNSSTNNV SESKLKGDKD SGGGRLEGIN GGEQRVPSVR QYNRSKLPRL  120
RWTPDLHMAF VHAVERLGGQ ERATPKLVLQ MMNVRGLSIA HVKSHLQMYR SKKLDHEGRQ  180
IRGAIASVFS PMDFHLMRGD RRFHDMLLQR AAALSSSRQE HGGFFSSRSG GGGGGLPPEA  240
SRLYGLLQHR QSPAIATMQT LDFKNSSFRN QEWSFSFNHQ RKETMNPSSS SSTTAAIRRW  300
PSAAGAVAVV AGERQRLAER FGYYTGNGGA SSTSLPLITR AAMAAPPPMF AAAVAPPGRD  360
HHRLPFGWHA GGGGGGGGNK NRSSSDPVVI DEALDSRRLE HQQKHVEQPR MTPTTTTTPA  420
GKRPPEWSPP DLQLTLSPTT APAAADGGGA KRSKTSTTTT NTTAAISGEQ EAEKNMDRCK  480
NKLSISLSLS PPAAAAAAAN FSSMDLSMEQ QKQKQEKTTI GSSEEEAGDL GQSTLDLTMS  540
IRALE*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ER41
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g14490.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g14490
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0056130.0AP005613.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0082C09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015625548.10.0PREDICTED: uncharacterized protein LOC107275964
TrEMBLQ6ER410.0Q6ER41_ORYSJ; Myb family transcription factor-like
STRINGLOC_Os02g14490.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.11e-34G2-like family protein