PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g10860.1
Common NameOs02g0203000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 361aa    MW: 38270 Da    PI: 10.6131
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g10860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.7e-14171232162
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                       +ke kr +r+ +NR++A+  R+RKka++  Le kvk Le++N++L ++ ++l++e + l++ 
  LOC_Os02g10860.1 171 DKEHKRLKRLLRNRVSAQQARERKKAYLNDLEVKVKDLEKKNSELEERFSTLQNENQMLRQI 232
                       5899*****************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.5E-15171235IPR004827Basic-leucine zipper domain
PfamPF001702.0E-13172233IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.461173236IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-16175235No hitNo description
SuperFamilySSF579596.88E-13175233No hitNo description
CDDcd147047.61E-21176227No hitNo description
PROSITE patternPS000360178193IPR004827Basic-leucine zipper domain
SuperFamilySSF498992.15E-14270349IPR013320Concanavalin A-like lectin/glucanase domain
PfamPF001391.0E-14271343IPR001220Legume lectin domain
Gene3DG3DSA:2.60.120.2005.7E-14271345IPR013320Concanavalin A-like lectin/glucanase domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0030246Molecular Functioncarbohydrate binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MATTRASLTD PLLPSPAARA PVKAKKLSWS MLHASSKDER RGQSGEAEAE ASGGVHANPS  60
SPARMQEQAT SSRPSSSERS SSSGGHHMEI KEGKEAPLRS LLLPFLDFHF TVPLSGMESD  120
EEIGRVPELG LEPGGASTSG RAAGGGGGGA ERAQSSTAQA SARRRGRSPA DKEHKRLKRL  180
LRNRVSAQQA RERKKAYLND LEVKVKDLEK KNSELEERFS TLQNENQMLR QILKNTTVSR  240
RGPVLLKIPK SGLREAAPAG CGGLREAEGD EKFVLNGFTA ANLSFDGMAT VTPNGLLMLT  300
NGTNQLKGHA FFPALLQFHR TPNSMAMQSF STAFVIGIIS AFEDQGSGSP AAAGGSGRAA  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2oqq_A4e-14196235342Transcription factor HY5
2oqq_B4e-14196235342Transcription factor HY5
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0E2Y8
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00117ampDAPTransfer from AT5G11260Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g10860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g10860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0040450.0AP004045.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1135_F06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623711.11e-102PREDICTED: transcription factor HY5
TrEMBLQ0E2Y80.0Q0E2Y8_ORYSJ; Os02g0203000 protein
STRINGLOC_Os02g10860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20811737
MonocotsOGMP140838111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11260.11e-37bZIP family protein