PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g10840.1
Common NameLOC4328660, Os02g0202800, OsJ_05805, OSNPB_020202800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family FAR1
P !E td style='width: 80%'>Length: 722aa    MW: 81612.9 Da    PI: 7.5914
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g10840.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR169.39.5e-2288174190
              FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                       +fYn+YA++vGFs+rk++ +++  +g+  ++ f Cs+eg++  ++++    r++r++tr +Cka+l+   +++g w v+k+el+H H l+
  LOC_Os02g10840.1  88 DFYNSYARNVGFSIRKNHANTR-ADGSLCSKYFLCSNEGQPVASTTQ--PGRKKRSSTRSDCKARLQFYISREGIWTVQKVELDHKHYLV 174
                       6***************997775.9999**************998877..9*************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-1888174IPR004330FAR1 DNA binding domain
PfamPF105517.6E-31289383IPR018289MULE transposase domain
PROSITE profilePS5096610.348570605IPR007527Zinc finger, SWIM-type
PfamPF044345.4E-5579603IPR007527Zinc finger, SWIM-type
SMARTSM005753.2E-5580607IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MSGPVVPLAW TAQGPCEPSP GSGPLPVSAA ASDPPAPSSS VPAGGREPSA SGLPPAVTPQ  60
LGDHDQGGLP NCVPKVGMTF NSENEAYDFY NSYARNVGFS IRKNHANTRA DGSLCSKYFL  120
CSNEGQPVAS TTQPGRKKRS STRSDCKARL QFYISREGIW TVQKVELDHK HYLVSPDKSH  180
MLRSQRRLTP SYQQIVNEMR QEGITAADMQ RVFRQWSRGA ENVHLLKKDT QRKYLQPSYA  240
QKLLEYLKNK QTENPSFFYA VQLNDDGRIA NFFWTDCQAI VDYACFGDVV SFDTTFETNK  300
FEMPFAPFVG TNHHKQPILF GASLIYDESS ESFNWLFQTF LTAMSGKQPA TIFTDPSAEI  360
IKSVRLVFPN SSHRLCLRHI CHNAVKHLNH VICNHPEFLS DFKRRIYEER SVTFFDLKWK  420
ELVNAYNLDG NDWMNNLYAM REKWAAVYSR DSFYADMMTI QNAEGTSDAL KNFRRKLCLP  480
EFLEEYEKCI TSFRQNELEA DYNSRQTSPV PYVPDLPMLK TAAESYTRNL YSHFEEEFKK  540
LFTLSCSLLS QDRTISTYKL TPLNSEEEAY VVFNSEDTTV SCSCRMYECT GMLCKHALRV  600
LNYSNIFTFP SHYVYKRWTK YAKAGLFGCR NNSQSGNGSS MLRCARISQK MHSVALRYSM  660
SEKALQFLES GVDKLTCEVE NLLSHINLNG NGNDTGQSSG FCNGAMAESL GHSESMYSEG  720
A*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.61910.0callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329872910.0
Expression AtlasQ0E2Z0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g10840.1
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g10840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1028130.0AK102813.1 Oryza sativa Japonica Group cDNA clone:J033108L18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626734.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5
TrEMBLQ0E2Z00.0Q0E2Z0_ORYSJ; Os02g0202800 protein
STRINGLOC_Os02g10840.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3012351
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-123FAR1-related sequence 5