PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g08544.3
Common NameHOS58, LOC4328520, Os02g0182800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 184aa    MW: 20606.9 Da    PI: 5.4063
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g08544.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.54.7e-081211542154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++++++L +++gL+ +q+ +WF N+R +
  LOC_Os02g08544.3 121 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 154
                       469*****************************87 PP

2ELK27.85.7e-107596122
               ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                      ELK++L+++Y+++L+++++E++
  LOC_Os02g08544.3 75 ELKNELKQGYKEKLVDIREEIL 96
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011880.00237596IPR005539ELK domain
PROSITE profilePS5121310.0577595IPR005539ELK domain
PfamPF037899.2E-77596IPR005539ELK domain
PROSITE profilePS5007111.35395158IPR001356Homeobox domain
SMARTSM003892.3E-1097162IPR001356Homeobox domain
SuperFamilySSF466892.74E-1697160IPR009057Homeodomain-like
CDDcd000861.23E-1198159No hitNo description
Gene3DG3DSA:1.10.10.603.8E-25102159IPR009057Homeodomain-like
PfamPF059203.7E-18115154IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MEAVMGCWEL EQSLQSLTGA SPGEGTGATM SDDEDNQVDS EANMFDGNDG SDGMGFGPLM  60
LTEGERSLVE RVRHELKNEL KQGYKEKLVD IREEILRKRR AGKLPGDTAS ILKAWWQAHS  120
KWPYPTEDDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP ASSGEKTKKK RNVTGDGGAE  180
QSW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A9e-1498162872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151170RKRNWHSNPASSGEKTKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.19830.0callus| leaf| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0E3C3
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Isoform 1 is expressed in roots, leaf blades, leaf sheaths and flowers. Isoform 2 is expressed in leaf blades, leaf sheaths and flowers. {ECO:0000269|PubMed:12034492}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g08544.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g08544
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0618170.0AB061817.1 Oryza sativa Japonica Group HOS58 mRNA for KNOX family class 2 homeodomain protein, partial cds.
GenBankAB0076270.0AB007627.2 Oryza sativa Japonica Group HOS58 mRNA, complete cds.
GenBankAK2433520.0AK243352.1 Oryza sativa Japonica Group cDNA, clone: J100060L07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626237.11e-133PREDICTED: homeobox protein knotted-1-like 2 isoform X1
SwissprotQ0E3C31e-135KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLA0A0E0JWG41e-134A0A0E0JWG4_ORYPU; Uncharacterized protein
TrEMBLI1NXX41e-134I1NXX4_ORYGL; Uncharacterized protein
STRINGORGLA02G0058000.11e-133(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-102KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ito Y,Hirochika H,Kurata N
    Organ-specific alternative transcripts of KNOX family class 2 homeobox genes of rice.
    Gene, 2002. 288(1-2): p. 41-7
    [PMID:12034492]
  2. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]