PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g08544.1
Common NameHOS58, LOC4328520, Os02g0182800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 314aa    MW: 33875.9 Da    PI: 6.0063
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g08544.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.6e-072512842154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp+++++++L +++gL+ +q+ +WF N+R +
  LOC_Os02g08544.1 251 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 284
                       469*****************************87 PP

2ELK26.81.2e-09205226122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK++L+++Y+++L+++++E++
  LOC_Os02g08544.1 205 ELKNELKQGYKEKLVDIREEIL 226
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-184084IPR005540KNOX1
PfamPF037901.8E-154380IPR005540KNOX1
SMARTSM012566.2E-2694149IPR005541KNOX2
PfamPF037914.7E-16102148IPR005541KNOX2
PfamPF037891.9E-6205226IPR005539ELK domain
SMARTSM011880.0023205226IPR005539ELK domain
PROSITE profilePS5121310.057205225IPR005539ELK domain
PROSITE profilePS5007111.353225288IPR001356Homeobox domain
SMARTSM003892.3E-10227292IPR001356Homeobox domain
SuperFamilySSF466897.7E-16227290IPR009057Homeodomain-like
CDDcd000861.21E-11228289No hitNo description
Gene3DG3DSA:1.10.10.601.0E-24232289IPR009057Homeodomain-like
PfamPF059208.7E-18245284IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MAFHYPDHGL AMDPSSAAAS SPNPSFSPGG GGGGGVGGGE REKAAVAAHP LYERLLEAHV  60
ACLRVATPVD QLPRIDAQIA ARPPPLAAAS AAAAAGGPSG GEELDLFMTH YVLLLCSFKE  120
QLQQHVRVHA MEAVMGCWEL EQSLQSLTGA SPGEGTGATM SDDEDNQVDS EANMFDGNDG  180
SDGMGFGPLM LTEGERSLVE RVRHELKNEL KQGYKEKLVD IREEILRKRR AGKLPGDTAS  240
ILKAWWQAHS KWPYPTEDDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP ASSGEKTKKK  300
RNVTGDGGAE QSW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1281300RKRNWHSNPASSGEKTKKKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.19830.0callus| leaf| root
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0E3C3
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Isoform 1 is expressed in roots, leaf blades, leaf sheaths and flowers. Isoform 2 is expressed in leaf blades, leaf sheaths and flowers. {ECO:0000269|PubMed:12034492}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g08544.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g08544
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2433520.0AK243352.1 Oryza sativa Japonica Group cDNA, clone: J100060L07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626237.10.0PREDICTED: homeobox protein knotted-1-like 2 isoform X1
SwissprotQ0E3C30.0KNOS2_ORYSJ; Homeobox protein knotted-1-like 2
TrEMBLI1NXX40.0I1NXX4_ORYGL; Uncharacterized protein
STRINGLOC_Os02g08544.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-144KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ito Y,Hirochika H,Kurata N
    Organ-specific alternative transcripts of KNOX family class 2 homeobox genes of rice.
    Gene, 2002. 288(1-2): p. 41-7
    [PMID:12034492]
  2. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]