PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g08540.1
Common NameLOC4328519, OJ1297_C09.35, Os02g0182700, OSNPB_020182700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 250aa    MW: 26086.2 Da    PI: 10.2093
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g08540.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.93.8e-071481902163
                       HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       R RKk+++   ++ v +L  eN++L++e+ +l+  +a+l +e+
  LOC_Os02g08540.1 148 RPRKKMRLPDVQQLVRSLAVENDSLREEMRTLQRACAALSKEN 190
                       89*************************************9997 PP

Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MDCAGDDDAV AAGIICSLRG ADLAGWTPPW WCSSSSKGAA REELIWPPVT RGKRSRRRSP  60
SAVAAAAGKK GRWARASPAS PLDYSGGSGS GSGSGSGSAA STSGGEDGAF CSPPGHRPAP  120
ATTKVSAMGR QQQLPFSAPS PLRPAGQRPR KKMRLPDVQQ LVRSLAVEND SLREEMRTLQ  180
RACAALSKEN DKLEIRLQIS SSRNKPMITE DLKGKQQIDQ QSATQSIGGG FALPDLNIPV  240
QDAADGSVH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147153RPRKKMR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.206420.0leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329928390.0
Expression AtlasQ6H7Z8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g08540.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g08540
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1076300.0AK107630.1 Oryza sativa Japonica Group cDNA clone:002-131-E03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626239.11e-179PREDICTED: uncharacterized protein LOC4328519 isoform X1
TrEMBLQ6H7Z81e-179Q6H7Z8_ORYSJ; Os02g0182700 protein
STRINGLOC_Os02g08540.11e-178(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1444622
MonocotsOGMP37902951