PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g08500.1
Common NameLOC4328516, OJ1297_C09.26, ORR4, Os02g0182100, OsJ_05635, RR24
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 627aa    MW: 68399 Da    PI: 6.5138
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g08500.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.3e-28213266155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kpr++W+ eLH++Fv av+qL G+ekA+Pk+il+lm+v+ +t+e+v+SHLQkYRl
  LOC_Os02g08500.1 213 KPRVVWSVELHRKFVAAVNQL-GIEKAVPKKILDLMNVENITRENVASHLQKYRL 266
                       79*******************.********************************8 PP

2Response_reg78.91.8e-26311391109
                       EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       vl vdD+p+ +++l+++l + +y +v+++ ++  al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+ge +++ + + 
  LOC_Os02g08500.1  31 VLAVDDDPTCLKILENLLLRCQY-HVTTTGQAATALKLLRENKdqFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSANGETQTVMKGIT 121
                       799********************.***************888889*******************87754.558******************** PP

                       TTESEEEESS--HHHHHH CS
      Response_reg  92 aGakdflsKpfdpeelvk 109
                        Ga d+l Kp+  e+l++
  LOC_Os02g08500.1 122 HGACDYLLKPVRLEQLRT 139
                       ***************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363923.3E-2001626IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.9E-4228168No hitNo description
SuperFamilySSF521722.56E-3528150IPR011006CheY-like superfamily
SMARTSM004481.8E-3229141IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.42530145IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.1E-2331140IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.21E-2732145No hitNo description
PROSITE profilePS5129410.912210269IPR017930Myb domain
SuperFamilySSF466891.24E-19210270IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-29211271IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-24213266IPR006447Myb domain, plants
PfamPF002493.8E-6215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MTVEERQGRV GGHGVSGGGG GRDQFPVGMR VLAVDDDPTC LKILENLLLR CQYHVTTTGQ  60
AATALKLLRE NKDQFDLVIS DVHMPDMDGF KLLELVGLEM DLPVIMLSAN GETQTVMKGI  120
THGACDYLLK PVRLEQLRTI WQHVIRRKNC DAKNRGNDDD AGQKAQGMNN EGESIGANRN  180
KRQSRKSRDE NGDDGDDSDE NSNENGDSST QKKPRVVWSV ELHRKFVAAV NQLGIEKAVP  240
KKILDLMNVE NITRENVASH LQKYRLYLKR LSTDASRQAN LAAAFGGRNP AYINMNSFGN  300
YNAYGRYRTV PTAGHTQANN ILTRMNSPSA FGVHGLLHSQ PIQLGHAQNN LSTSLNDLGG  360
LNNGNMIRGA QMSTILTGPS GNSFPNISNG APLATANRSL QPLESSNQQH LSRVHSSSAD  420
PFSTLVGESP QFPDLGRTTN TWQTAVPSNI QDRGHNDNMS QATLHMNGPK IEPVSSFTSS  480
NQIPLLGNEM QGQVASLASN VPIAFNQDTS PFNYGSSTNS RDMLNNSHVF SNSSINTSLP  540
NLSLDNPAVP RQTLDRGNTG IVSPMQDGRI HHQAVSNQLN YNDDLMRTTG LQRGLSGGLD  600
DIVVDMFRPD REDDGVPYID GDWELV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-26209272164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.278470.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329857390.0
Expression AtlasQ6H805-
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g08500.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, narrow leaf, lesion mimic, low tillering, late heading and low fertility phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g08500
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1005300.0AK100530.1 Oryza sativa Japonica Group cDNA clone:J023101H04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626716.10.0PREDICTED: two-component response regulator ORR24
SwissprotQ6H8050.0ORR24_ORYSJ; Two-component response regulator ORR24
TrEMBLA0A0D3F1L60.0A0A0D3F1L6_9ORYZ; Uncharacterized protein
TrEMBLI1NXW90.0I1NXW9_ORYGL; Uncharacterized protein
STRINGLOC_Os02g08500.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
MonocotsOGMP81473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-113response regulator 12
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Ito Y,Kurata N
    Identification and characterization of cytokinin-signalling gene families in rice.
    Gene, 2006. 382: p. 57-65
    [PMID:16919402]
  3. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]