PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g08150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 350aa    MW: 35969.4 Da    PI: 6.6561
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g08150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.89e-0859104342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        ++C+ +e  ++   C+ +   lC+ C + +H        H++vp+
  LOC_Os02g08150.1  59 VWVCEVCELAPAAVTCKADAAALCAACDSDIHDAnplarrHERVPV 104
                       689*****************************44788888999986 PP

2CCT69.58.6e-24281324144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       R+a+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpRvKGrF+k+a
  LOC_Os02g08150.1 281 RAARLMRYREKRKNRRFEKTIRYASRKAYAETRPRVKGRFAKRA 324
                       99****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0551361IPR000315B-box-type zinc finger
PROSITE profilePS5011910.60857104IPR000315B-box-type zinc finger
PfamPF006431.4E-558104IPR000315B-box-type zinc finger
SMARTSM003362.8E-862104IPR000315B-box-type zinc finger
PfamPF062031.0E-17281323IPR010402CCT domain
PROSITE profilePS5101716.807281323IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEMELGLGRY WGVGRRRCGA CAVAPAAVHC RTCDGDGGGG GYLCAGCDAE HGRAGHERVW  60
VCEVCELAPA AVTCKADAAA LCAACDSDIH DANPLARRHE RVPVHPIGSS AAPPPDALLL  120
GGENDAAAAV DGGGGGKEVK LDFLFADFMD PYLGGSPELA RFPHADSVVP NHNGSAGPAM  180
ELGFAGGGGA AVKPSYSSYT AASLGNSGSS SEVGLVPDAI CGGGGGGIIE LDFAQSKAAY  240
LPYASTPSHS MSSSMDMGVA APEMSDCAAA AAGRAYAAEG RAARLMRYRE KRKNRRFEKT  300
IRYASRKAYA ETRPRVKGRF AKRADDHDAA APPPQIMLDF AGYGVVPTF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.139990.0callus| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329948390.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g08150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g08150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096300.0AK109630.1 Oryza sativa Japonica Group cDNA clone:002-138-D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623284.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0E0G2G40.0A0A0E0G2G4_ORYNI; Uncharacterized protein
STRINGLOC_Os02g08150.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.16e-20CONSTANS-like 4