PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g08070.1
Common NameOs02g0177300, P0504A05.16, SPL5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 459aa    MW: 48112.6 Da    PI: 6.7658
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g08070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.52.6e-40196272177
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       +Cq+egC+adls ak+yhrrhkvC++h+ka++vl++g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk++
  LOC_Os02g08070.1 196 RCQAEGCKADLSAAKHYHRRHKVCDFHAKAAAVLAAGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKPT 272
                       6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33190258IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.111194271IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-38195273IPR004333Transcription factor, SBP-box
PfamPF031103.1E-30197270IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 459 aa     Download sequence    Send to blast
MAVPAAAVAA DVVDFGYAAP MPPPYVGFDP AGMGGERQLF QHGGACHGLY DGGLDFSAAA  60
AFQEAATLGV GLPGGNLLQS LAPPAAAAAT PSSLQMPMMM SLPGLPATAA DVYPFGGGGF  120
VKREDGPVLD VVGGGGGGRI GLNLGRRTYF SPADVLAVDR LLLRSRLGGM GMEMGMGMGV  180
LGLGLAAAAH HHQPPRCQAE GCKADLSAAK HYHRRHKVCD FHAKAAAVLA AGKQQRFCQQ  240
CSRFHVLAEF DEAKRSCRKR LTEHNRRRRK PTAGGQSSKD SPPPPPSKKG TDASIASSYT  300
SCDHHKAAAS TTTASGVSCL QELADHHDVG GGHQAAMAAA PPPTLSLAAL PPQEEDDEDE  360
DGGLGNVLMM QQHHQRRRLQ HDGDGDDDVA AAAAHHHLMR SLARQQQQHR HSSGCSNNND  420
GDDDDHNNNN NILSCSSASD QQNSSNNNNM HFFEVDFI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281972701184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253270KRSCRKRLTEHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.798050.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0E3F8
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g08070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g08070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0048380.0AP004838.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, PAC clone:P0504A05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624330.11e-165PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ0E3F80.0SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLB9F3D10.0B9F3D1_ORYSJ; Uncharacterized protein
STRINGLOC_Os02g08070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.14e-33squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]