PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g07780.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 235aa    MW: 26230.7 Da    PI: 10.0701
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g07780.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.11.4e-3967144178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC ++l  +k+yhr+h+vCe+hsk p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL +hn+rrrk+q+
  LOC_Os02g07780.2  67 RCQVEGCGVELVGVKDYHRKHRVCEAHSKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLYDHNARRRKPQT 144
                       6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-3360129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.66765142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.14E-3866148IPR004333Transcription factor, SBP-box
PfamPF031108.5E-3168141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDWMPPPKPT SPRSPPLLWD WADAAVPGSS SGEVSAAAAA AAAHPGRRRK EKRGRAEEGG  60
GGGGEVRCQV EGCGVELVGV KDYHRKHRVC EAHSKFPRVV VAGQERRFCQ QCSRFHALSE  120
FDQKKRSCRR RLYDHNARRR KPQTDVFSYA SARPPSSLLF DDNRQISFVW NKAPLSHVRP  180
FAISPWESSS EVGTTDGHIY LDKSHISKSL PAFNTDIDEL LPMKGMIFQR CKFS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2561141484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14651RRRKEK
2123140KKRSCRRRLYDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.513670.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329787190.0
Expression AtlasB7E6G1-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g07780.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g07780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687020.0AK068702.1 Oryza sativa Japonica Group cDNA clone:J013159I15, full insert sequence.
GenBankAK0614840.0AK061484.1 Oryza sativa Japonica Group cDNA clone:006-308-H09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623075.11e-173PREDICTED: squamosa promoter-binding-like protein 4 isoform X1
SwissprotQ6H5091e-168SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLB7E6G11e-174B7E6G1_ORYSJ; cDNA clone:006-308-H09, full insert sequence
STRINGLOC_Os02g07780.11e-165(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-37squamosa promoter binding protein-like 2