PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g07780.1
Common NameLOC4328461, Os02g0174100, OSJNBa0073A21.21-1, OSJNBa0073A21.21-2, OSJNBa0073A21.21-3, SPL4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 252aa    MW: 28157.8 Da    PI: 9.5681
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g07780.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.91.6e-3967144178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC ++l  +k+yhr+h+vCe+hsk p v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL +hn+rrrk+q+
  LOC_Os02g07780.1  67 RCQVEGCGVELVGVKDYHRKHRVCEAHSKFPRVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLYDHNARRRKPQT 144
                       6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-3360129IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.66765142IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-3866148IPR004333Transcription factor, SBP-box
PfamPF031109.7E-3168141IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MDWMPPPKPT SPRSPPLLWD WADAAVPGSS SGEVSAAAAA AAAHPGRRRK EKRGRAEEGG  60
GGGGEVRCQV EGCGVELVGV KDYHRKHRVC EAHSKFPRVV VAGQERRFCQ QCSRFHALSE  120
FDQKKRSCRR RLYDHNARRR KPQTDVFSYA SARPPSSLLF DDNRQISFVW NKAPLSHVRP  180
FAISPWESSS EVGTTDGHIY LDKSHISKSL PAFNTDIDEL LPMKDFSAAT IWMFFGVLFI  240
RTAQESCMSF H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-2561141484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14651RRRKEK
2123140KKRSCRRRLYDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.513670.0callus| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329787190.0
Expression AtlasQ6H509-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g07780.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g07780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0660570.0AK066057.1 Oryza sativa Japonica Group cDNA clone:J013053E16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623077.10.0PREDICTED: squamosa promoter-binding-like protein 4 isoform X3
SwissprotQ6H5090.0SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLB7EBQ00.0B7EBQ0_ORYSJ; SBP transcription factor
STRINGLOC_Os02g07780.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.36e-38squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]