PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g07770.1
Common NameOs02g0174000, OSJNBa0073A21.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Length: 356aa    MW: 37962 Da    PI: 7.2115
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g07770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.91.1e-331670155
           G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  LOC_Os02g07770.1 16 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 70
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.3471373IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-321371IPR009057Homeodomain-like
SuperFamilySSF466891.61E-161571IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-231671IPR006447Myb domain, plants
PfamPF002491.1E-71868IPR001005SANT/Myb domain
PfamPF143793.9E-25111157IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MCVQGDSGLV LTTDPKPRLR WTVELHERFV DAVTQLGGPD KATPKTIMRV MGVKGLTLYH  60
LKSHLQKFRL GKQPHKEFSE HSVKEAAAME MQRNAASSSG IMGRSMNHDR NVNDAIRMQM  120
EVQRRLHEQL EVQKHLQMRI EAQGKYMQSI LEKAYQTLAA GDVAAAVACG PAGYKSLGNH  180
QAAVLDVCSM GFPSLQDLHM YGGAGGGHLD LQQQQPPAST MESFFACGDG GGSLGKTAAK  240
TRHYGGAGKS PMMWGVDDDD DDDDPAGKCG GGGHHQLQMA PPPMMDGGID VMDSLAADVY  300
ETKPIMSGDS TGSKGGGYDV AAAASKLERP SPRRPPQLGS PSVMAGAQTR NLSYG*
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2975986730.0
Expression AtlasQ6H510-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g07770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g07770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0057720.0AP005772.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0073A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624013.10.0PREDICTED: myb family transcription factor APL isoform X1
SwissprotQ9SAK51e-100APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0D3F1D70.0A0A0D3F1D7_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0G2380.0A0A0E0G238_ORYNI; Uncharacterized protein
TrEMBLA0A0E0NAK00.0A0A0E0NAK0_ORYRU; Uncharacterized protein
TrEMBLQ6H5100.0Q6H510_ORYSJ; Myb family transcription factor-like
STRINGLOC_Os02g07770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.27e-96G2-like family protein