PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g07170.1
Common NameLOC4328426, Os02g0168200, OSJNBa0085K21.53, OSNPB_020168200, P0669G09.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 236aa    MW: 25800.8 Da    PI: 9.4843
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g07170.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.91.3e-293386255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      pr+rW +eLH+rFv+av++LGG ++AtPk+i++lm+ kg++++hvkSHLQ+YR 
  LOC_Os02g07170.1 33 PRMRWPEELHRRFVHAVRRLGGCHEATPKRIMQLMGAKGVSISHVKSHLQMYRN 86
                      9****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-272987IPR009057Homeodomain-like
SuperFamilySSF466893.4E-143187IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-223386IPR006447Myb domain, plants
PfamPF002498.5E-83485IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MGARGRRDRM GSAGGGGGSP PVVVRRYNRS EAPRMRWPEE LHRRFVHAVR RLGGCHEATP  60
KRIMQLMGAK GVSISHVKSH LQMYRNSNNS SNVNRRHPVT PQIDWTTTAQ QDEQQRRQMS  120
SFSFLATRTV PAAGIGSHSH QRPHRRQALH AGDDDGCELT LSISGGAAEE SKDGGSSITD  180
DDDELLIQPP APNIINDDGS TRHGHRHPFA CSTQPLPPAA INLELTISSP CCWLT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.555010.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6H4V0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g07170.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g07170
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8314000.0CT831400.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA117D12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624627.11e-175PREDICTED: two-component response regulator ARR18
TrEMBLQ6H4V01e-175Q6H4V0_ORYSJ; Os02g0168200 protein
STRINGLOC_Os02g07170.11e-175(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP1991088
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-20G2-like family protein