PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g06950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 504aa    MW: 57371.1 Da    PI: 7.3686
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g06950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.65.2e-4961441128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...lelee............vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknrat 78 
                       lppGfrFhP+d+elvv+yL  k+++ +       +            ++ +vd++k+ePwdLp+ +  + kewyf+  +d+kya+g+r+nrat
  LOC_Os02g06950.1   6 LPPGFRFHPRDDELVVDYLSGKLRSGDggaA---SgggaagagcptpTLIDVDLNKCEPWDLPEIACIGGKEWYFYNLKDRKYARGQRTNRAT 95 
                       79**********************9996650...23455555666556999************7666789*********************** PP

               NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +sgyWkatgkd+e+++ kg+lvg++ktLvfy+grapkge+tdWvmhe+r 
  LOC_Os02g06950.1  96 ESGYWKATGKDREITR-KGSLVGMRKTLVFYRGRAPKGERTDWVMHEFRQ 144
                       ***************9.999****************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.06E-543154IPR003441NAC domain
PROSITE profilePS5100551.3396196IPR003441NAC domain
PfamPF023657.8E-247143IPR003441NAC domain
SuperFamilySSF1019411.06E-54184196IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 504 aa     Download sequence    Send to blast
MVEARLPPGF RFHPRDDELV VDYLSGKLRS GDGGAASGGG AAGAGCPTPT LIDVDLNKCE  60
PWDLPEIACI GGKEWYFYNL KDRKYARGQR TNRATESGYW KATGKDREIT RKGSLVGMRK  120
TLVFYRGRAP KGERTDWVMH EFRQELDHAN HHHHLKVLAH RFRFQFALDC IISHSHASWQ  180
LDYMQEGWVL CRVFYKSRTE AVAAPTMEST LPPRYINGGT SRSPLPPLVD SSISFNHGGY  240
EEVLPCFSSS HHQQPSPASM NASAAADDDQ DYHHLSEGQR HYSDKKMMRD VQNDQVTTRF  300
DGHLAVKREM SLKKDLSEDE QAAPNADAGG FSILLKYSVS KMTSLMKPIQ RNISTLQEFL  360
NQKKEAILEK VEIFTKLLLP SRLGSAVFQL CLEHLIKNHK VGISWDGIWE LSDWEVADNE  420
VVLKMVGQCS APADSKSKDL KRLFDLLRPY YDQEGKDPHL FFEHLKFDFT DVLKTIVTDA  480
KWEWFWKYLL NHVFVMPPTG NTY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-44214311139Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g06950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g06950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0058040.0AP005804.2 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0085K21.
GenBankAP0048630.0AP004863.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0023I17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624259.10.0PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A0E0NAB20.0A0A0E0NAB2_ORYRU; Uncharacterized protein
STRINGLOC_Os02g06950.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP1753499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.24e-71NAC domain containing protein 1