PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g06860.1
Common NameOJ1661_C12.19, Os02g0164450, OSJNBa0023I17.2, OSNPB_020164450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 287aa    MW: 30761.7 Da    PI: 6.5863
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g06860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.12e-223074145
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                      k ienk  rqv fskRr+g++KKA+ELSvLC+a+vav+ fs+ g+
  LOC_Os02g06860.1 30 KLIENKEARQVCFSKRREGVFKKASELSVLCGARVAVVFFSPAGR 74
                      569***************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.8382282IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-282281IPR002100Transcription factor, MADS-box
CDDcd002654.88E-332391No hitNo description
SuperFamilySSF554555.62E-262391IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-172444IPR002100Transcription factor, MADS-box
PfamPF003191.8E-243278IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-174459IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-175980IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MAKAAAEMDV GGGEGRRWKR TRGRQRIEMK LIENKEARQV CFSKRREGVF KKASELSVLC  60
GARVAVVFFS PAGRPHCFGH PSVSAVADRF LLGRSPADAA AAAAEEEEAV VREFNRVEER  120
LKDALGAAAR RRDALDEAAR VAGVWNDADV RRAGLADLVS MLAALQRVQA EASERVHDII  180
VEEAMTHYTG AAAAAANLID YLDAGPLVSH SPGSHDTTTK LIGGNAVHAP PLSFPPMIMP  240
PPLPPQFSHG FGYTDLAAGY GYNLDHGHGA AYETEEFHNA AACDFF*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6H6V9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g06860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g06860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0048630.0AP004863.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0023I17.
GenBankAP0040930.0AP004093.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1661_C12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624326.11e-137PREDICTED: MADS-box transcription factor 50-like
TrEMBLQ6H6V90.0Q6H6V9_ORYSJ; Os02g0164450 protein
STRINGLOC_Os02g06860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1690233
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.18e-21AGAMOUS-like 29