PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g06370.1
Common NameB1103G11.17, LOC4328365, Os02g0158400, OsJ_05450, OSNPB_020158400, P0419H03.37
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Whirly
Protein Properties Length: 229aa    MW: 25197.6 Da    PI: 10.289
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g06370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly182.86.5e-57521892139
            Whirly   2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkal 94 
                       v+k+kaal++++++p+f++l+sg  +++++G+++l++ +a+++rkyd++kkq fals+tev++l++l++ esceffhdp++k+s+eG+v+k+l
  LOC_Os02g06370.1  52 VFKGKAALSMQPILPSFSKLESGGSRVNKNGSVMLTFFPAVGQRKYDYSKKQLFALSPTEVGSLISLGPAESCEFFHDPSMKSSHEGQVKKSL 144
                       9******************************************************************************************** PP

            Whirly  95 kvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                       +v Pl + sG+f+n++v n+l+k+ e++s+P+skaef+v+r++l+
  LOC_Os02g06370.1 145 SVTPLGNDSGYFLNITVLNNLQKTTERLSLPISKAEFTVMRTALS 189
                       ******************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.106.2E-7339208IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.88E-7543228IPR009044ssDNA-binding transcriptional regulator
PfamPF085368.6E-5852186IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MQRLSRFVPS SSRRVTDLKD ALWSGSLTFQ HALSTFAADE NTSGRKFASY TVFKGKAALS  60
MQPILPSFSK LESGGSRVNK NGSVMLTFFP AVGQRKYDYS KKQLFALSPT EVGSLISLGP  120
AESCEFFHDP SMKSSHEGQV KKSLSVTPLG NDSGYFLNIT VLNNLQKTTE RLSLPISKAE  180
FTVMRTALSF ALPHILGWDQ ALTNHQPSPS PASKPRVERP HPDSEWER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A6e-73432058169Single-stranded DNA-binding protein WHY2, mit
4kop_B6e-73432058169Single-stranded DNA-binding protein WHY2, mit
4kop_C6e-73432058169Single-stranded DNA-binding protein WHY2, mit
4kop_D6e-73432058169Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.324500.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329899770.0
Expression AtlasQ6ET43-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g06370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g06370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8285100.0CT828510.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA129J03, full insert sequence.
GenBankAK1047680.0AK104768.1 Oryza sativa Japonica Group cDNA clone:001-039-A03, full insert sequence.
GenBankAK0994790.0AK099479.1 Oryza sativa Japonica Group cDNA clone:J013025B22, full insert sequence.
GenBankAK0615690.0AK061569.1 Oryza sativa Japonica Group cDNA clone:006-311-F08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015627387.11e-168PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0342e-76WHY2_SOLTU; Single-stranded DNA-bindig protein WHY2, mitochondrial
TrEMBLB8AI561e-168B8AI56_ORYSI; Putative uncharacterized protein
TrEMBLI1NXF61e-168I1NXF6_ORYGL; Uncharacterized protein
TrEMBLQ6ET431e-168Q6ET43_ORYSJ; Os02g0158400 protein
STRINGBGIOSGA007096-PA1e-168(Oryza sativa Indica Group)
STRINGLOC_Os02g06370.11e-168(Oryza sativa Japonica Group)
STRINGORGLA02G0041200.11e-168(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23161635
MonocotsOGMP30123885
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.12e-74WHIRLY 2