PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os02g05640.1
Common NameHOX26, LOC107276233, Os02g0149900, OsJ_005235, OSJNBa0050G13.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 238aa    MW: 25593.7 Da    PI: 9.5513
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os02g05640.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.7e-19105159256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++t eq + Le+ F+ ++ +s++e++eLA klgL+ rqV vWFqNrRa+ k
  LOC_Os02g05640.1 105 RKKLRLTGEQATLLEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQNRRARTK 159
                       788899***********************************************98 PP

2HD-ZIP_I/II114.85.3e-37105193189
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                       +kk+rl+ eq++lLE+sF++++ L++ +K+ela +Lgl++rqv+vWFqnrRARtk+kq+E d++ L+r++d+l+++n+rL+++ +eLr+
  LOC_Os02g05640.1 105 RKKLRLTGEQATLLEDSFRAHNILSHAEKQELAGKLGLSARQVEVWFQNRRARTKLKQTEADCDLLRRWCDHLAADNARLRRDLAELRR 193
                       69*************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1884162IPR009057Homeodomain-like
PROSITE profilePS5007117.378101161IPR001356Homeobox domain
SMARTSM003893.2E-16103165IPR001356Homeobox domain
SuperFamilySSF466891.63E-18104170IPR009057Homeodomain-like
CDDcd000865.81E-14105162No hitNo description
PfamPF000466.4E-17105159IPR001356Homeobox domain
PRINTSPR000318.6E-7132141IPR000047Helix-turn-helix motif
PROSITE patternPS000270136159IPR017970Homeobox, conserved site
PRINTSPR000318.6E-7141157IPR000047Helix-turn-helix motif
PfamPF021832.5E-7161192IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-10161204IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MDSVVDGGLD TRLSLAVGCC PPRRRPVLLF GEVLPSPEKK VAAAAVVAAG KRGREQRGEA  60
EAEATTTRQR RSCKKGRRGR GDDDDDDGDR RSPSGGGGDE EGASRKKLRL TGEQATLLED  120
SFRAHNILSH AEKQELAGKL GLSARQVEVW FQNRRARTKL KQTEADCDLL RRWCDHLAAD  180
NARLRRDLAE LRRSSSSPPV SGLAVATPVV CPSCAHDDKR RLAFATAAAA AGDMASN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1103109SRKKLRL
2153161RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ67UX6
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os02g05640.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs02g05640
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
GenBankAP0149580.0AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankAP0054120.0AP005412.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0050G13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624893.11e-169PREDICTED: putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX61e-171HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLA0A0D9YMB21e-169A0A0D9YMB2_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0N9W31e-169A0A0E0N9W3_ORYRU; Uncharacterized protein
STRINGBGIOSGA007547-PA1e-168(Oryza sativa Indica Group)
STRINGLOC_Os02g05640.11e-168(Oryza sativa Japonica Group)
STRINGORGLA02G0035900.11e-168(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-27homeobox protein 2
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]